Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2T9YAG3

Protein Details
Accession A0A2T9YAG3    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
10-30LKPCRLAWWASKKKKFPPECLHydrophilic
NLS Segment(s)
PositionSequence
43-170GKGAAGKGAAGKGAAGKGAAGKGAAGKGAAGKGAAGKGAAGKGAAGKGAAGKGAAGKGAAGKGAAGKGAAGKGAAGKGAAGKGAAGKGAAGKGAAGKGAAGKGAAGKGAAGKGAAGKGAAGKGAAGKG
Subcellular Location(s) mito 23, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR009970  HC2  
Gene Ontology GO:0003677  F:DNA binding  
GO:0030527  F:structural constituent of chromatin  
GO:0030261  P:chromosome condensation  
Pfam View protein in Pfam  
PF07382  HC2  
Amino Acid Sequences MLSLPSFPSLKPCRLAWWASKKKKFPPECLLPKALDSILGAAGKGAAGKGAAGKGAAGKGAAGKGAAGKGAAGKGAAGKGAAGKGAAGKGAAGKGAAGKGAAGKGAAGKGAAGKGAAGKGAAGKGAAGKGAAGKGAAGKGAAGKGAAGKGAAGKGAAGKGAAGKGAAGKGAAGTFGAFG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.46
3 0.46
4 0.52
5 0.58
6 0.65
7 0.73
8 0.74
9 0.78
10 0.84
11 0.82
12 0.8
13 0.78
14 0.79
15 0.79
16 0.78
17 0.72
18 0.62
19 0.55
20 0.49
21 0.39
22 0.29
23 0.19
24 0.14
25 0.13
26 0.12
27 0.11
28 0.08
29 0.08
30 0.07
31 0.07
32 0.05
33 0.03
34 0.03
35 0.04
36 0.05
37 0.05
38 0.05
39 0.05
40 0.06
41 0.07
42 0.07
43 0.07
44 0.06
45 0.06
46 0.07
47 0.07
48 0.07
49 0.06
50 0.06
51 0.07
52 0.07
53 0.07
54 0.06
55 0.06
56 0.07
57 0.07
58 0.07
59 0.06
60 0.06
61 0.07
62 0.07
63 0.07
64 0.06
65 0.06
66 0.07
67 0.07
68 0.07
69 0.06
70 0.06
71 0.07
72 0.07
73 0.07
74 0.06
75 0.06
76 0.07
77 0.07
78 0.07
79 0.06
80 0.06
81 0.07
82 0.07
83 0.07
84 0.06
85 0.06
86 0.07
87 0.07
88 0.07
89 0.06
90 0.06
91 0.07
92 0.07
93 0.07
94 0.06
95 0.06
96 0.07
97 0.07
98 0.07
99 0.06
100 0.06
101 0.07
102 0.07
103 0.07
104 0.06
105 0.06
106 0.07
107 0.07
108 0.07
109 0.06
110 0.06
111 0.07
112 0.07
113 0.07
114 0.06
115 0.06
116 0.07
117 0.07
118 0.07
119 0.06
120 0.06
121 0.07
122 0.07
123 0.07
124 0.06
125 0.06
126 0.07
127 0.07
128 0.07
129 0.06
130 0.06
131 0.07
132 0.07
133 0.07
134 0.06
135 0.06
136 0.07
137 0.07
138 0.07
139 0.06
140 0.06
141 0.07
142 0.07
143 0.07
144 0.06
145 0.06
146 0.07
147 0.07
148 0.07
149 0.06
150 0.06
151 0.07
152 0.07
153 0.07
154 0.06
155 0.06
156 0.06
157 0.07
158 0.07
159 0.06