Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T9YMJ1

Protein Details
Accession A0A2T9YMJ1   
Localization Confidence Medium
Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
113-138TVYKAEIQFKKRRRRTDSERRALPTNHydrophilic
NLS Segment(s)
PositionSequence
123-127KRRRR
Subcellular Location(s) nucl 13, mito 10, cyto 4
Family & Domain DBs
Amino Acid Sequences MATKVSGTLTSNNKIEMMVINVHIPSSSTKKKQVTEQIATFARNYKLKHPGHTKMSVRVGRTLSNTVDYNYGVRQGCPASPILFDFYINDLLDNIATSFEIDVKESHFYTFPTVYKAEIQFKKRRRRTDSERRALPTNSVNDTNQIR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.26
3 0.2
4 0.18
5 0.14
6 0.14
7 0.14
8 0.14
9 0.14
10 0.13
11 0.12
12 0.13
13 0.19
14 0.26
15 0.3
16 0.38
17 0.44
18 0.47
19 0.55
20 0.61
21 0.62
22 0.61
23 0.58
24 0.56
25 0.52
26 0.5
27 0.42
28 0.36
29 0.31
30 0.28
31 0.28
32 0.28
33 0.36
34 0.37
35 0.45
36 0.48
37 0.52
38 0.53
39 0.6
40 0.56
41 0.53
42 0.59
43 0.54
44 0.47
45 0.45
46 0.4
47 0.34
48 0.34
49 0.3
50 0.23
51 0.22
52 0.21
53 0.17
54 0.17
55 0.15
56 0.13
57 0.11
58 0.15
59 0.12
60 0.11
61 0.12
62 0.12
63 0.11
64 0.12
65 0.12
66 0.09
67 0.09
68 0.09
69 0.11
70 0.1
71 0.1
72 0.1
73 0.11
74 0.12
75 0.12
76 0.11
77 0.09
78 0.08
79 0.08
80 0.08
81 0.06
82 0.04
83 0.04
84 0.04
85 0.04
86 0.05
87 0.06
88 0.07
89 0.07
90 0.08
91 0.11
92 0.11
93 0.12
94 0.12
95 0.12
96 0.16
97 0.18
98 0.17
99 0.18
100 0.18
101 0.19
102 0.23
103 0.27
104 0.32
105 0.36
106 0.43
107 0.49
108 0.58
109 0.68
110 0.71
111 0.78
112 0.77
113 0.81
114 0.84
115 0.86
116 0.88
117 0.87
118 0.86
119 0.81
120 0.78
121 0.69
122 0.63
123 0.59
124 0.53
125 0.48
126 0.44
127 0.4