Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T9Y805

Protein Details
Accession A0A2T9Y805   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
2-32TEYLNKKTSQYKNSKKSTKINKTPTWKNITDHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14, mito_nucl 12.999, mito 10.5, cyto_nucl 9.833
Family & Domain DBs
Amino Acid Sequences MTEYLNKKTSQYKNSKKSTKINKTPTWKNITDLKELSIKNKKLVNELKNEQNAPNSSNKYLACWGIDKISAESVLRVVKVHTSIKSELNISKKNKQIENIDSSLLKTLKSVSVSGSGSGLMTKRRIS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.85
3 0.83
4 0.84
5 0.85
6 0.85
7 0.85
8 0.84
9 0.83
10 0.84
11 0.86
12 0.84
13 0.8
14 0.7
15 0.64
16 0.62
17 0.57
18 0.54
19 0.45
20 0.39
21 0.38
22 0.37
23 0.41
24 0.42
25 0.39
26 0.38
27 0.41
28 0.39
29 0.41
30 0.49
31 0.47
32 0.46
33 0.48
34 0.51
35 0.5
36 0.51
37 0.43
38 0.38
39 0.34
40 0.29
41 0.3
42 0.26
43 0.23
44 0.25
45 0.24
46 0.22
47 0.22
48 0.21
49 0.16
50 0.14
51 0.14
52 0.11
53 0.12
54 0.11
55 0.1
56 0.1
57 0.09
58 0.08
59 0.08
60 0.08
61 0.08
62 0.08
63 0.07
64 0.07
65 0.08
66 0.12
67 0.15
68 0.15
69 0.18
70 0.2
71 0.22
72 0.24
73 0.25
74 0.25
75 0.29
76 0.35
77 0.37
78 0.42
79 0.45
80 0.5
81 0.51
82 0.52
83 0.52
84 0.51
85 0.53
86 0.47
87 0.44
88 0.38
89 0.36
90 0.35
91 0.28
92 0.22
93 0.15
94 0.16
95 0.17
96 0.19
97 0.19
98 0.15
99 0.2
100 0.21
101 0.21
102 0.2
103 0.16
104 0.14
105 0.16
106 0.16
107 0.15