Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2T9YSI7

Protein Details
Accession A0A2T9YSI7    Localization Confidence Low Confidence Score 7.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MSRVQQKKLSKQERQYQKIVHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 8.5, mito 8, cyto_nucl 7, cyto 4.5, plas 2, pero 2, golg 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR015898  G-protein_gamma-like_dom  
IPR036284  GGL_sf  
IPR041848  Ste18_fungal  
Gene Ontology GO:0031681  F:G-protein beta-subunit binding  
GO:0007186  P:G protein-coupled receptor signaling pathway  
GO:0000750  P:pheromone-dependent signal transduction involved in conjugation with cellular fusion  
Pfam View protein in Pfam  
PF00631  G-gamma  
PROSITE View protein in PROSITE  
PS50058  G_PROTEIN_GAMMA  
Amino Acid Sequences MSRVQQKKLSKQERQYQKIVILNQQLTEELNKPKIPVSQASDALVSYVQNTTDPLLPAIWGRNEADPYADKPSSSCCIIICIFANFFVEIVLKTGLVFADE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.78
3 0.7
4 0.66
5 0.62
6 0.55
7 0.51
8 0.47
9 0.42
10 0.38
11 0.34
12 0.28
13 0.24
14 0.24
15 0.21
16 0.18
17 0.21
18 0.2
19 0.2
20 0.22
21 0.24
22 0.24
23 0.24
24 0.26
25 0.27
26 0.27
27 0.27
28 0.26
29 0.23
30 0.2
31 0.16
32 0.1
33 0.07
34 0.06
35 0.05
36 0.05
37 0.06
38 0.06
39 0.08
40 0.08
41 0.08
42 0.07
43 0.07
44 0.08
45 0.09
46 0.09
47 0.09
48 0.1
49 0.11
50 0.12
51 0.12
52 0.13
53 0.13
54 0.15
55 0.2
56 0.19
57 0.17
58 0.17
59 0.21
60 0.22
61 0.22
62 0.2
63 0.14
64 0.18
65 0.18
66 0.2
67 0.17
68 0.16
69 0.15
70 0.15
71 0.16
72 0.12
73 0.12
74 0.1
75 0.1
76 0.08
77 0.1
78 0.1
79 0.08
80 0.08
81 0.09