Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T9YHP0

Protein Details
Accession A0A2T9YHP0   
Localization Confidence Medium
Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
10-37ESNDKDYGKSRSKHRDRYSKSPVNRSDRHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 26.5, cyto_nucl 14
Family & Domain DBs
Amino Acid Sequences MEITVDTRRESNDKDYGKSRSKHRDRYSKSPVNRSDRAEFHYNEKHKFSRENKVNSGDFSDKDITKVRHMSSRDREYYRDNHRKAYNSSHNRNSDYKRTSRSRSPQRKSYSITSVKNQLEDSEKARKAKLLELMAQDAKKVNEHRKQYVNEIRSKEKEEEMELNEERIKHSKQGTTTSYLQNIADSAYGQLSTISLEDRLRRNRAFISKELASGE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.48
3 0.53
4 0.57
5 0.59
6 0.62
7 0.64
8 0.71
9 0.77
10 0.81
11 0.83
12 0.83
13 0.87
14 0.88
15 0.87
16 0.84
17 0.84
18 0.83
19 0.8
20 0.78
21 0.73
22 0.69
23 0.63
24 0.61
25 0.57
26 0.49
27 0.48
28 0.52
29 0.51
30 0.49
31 0.51
32 0.49
33 0.46
34 0.54
35 0.52
36 0.54
37 0.58
38 0.61
39 0.61
40 0.64
41 0.61
42 0.53
43 0.53
44 0.44
45 0.36
46 0.33
47 0.31
48 0.25
49 0.26
50 0.3
51 0.27
52 0.29
53 0.32
54 0.29
55 0.32
56 0.35
57 0.42
58 0.45
59 0.51
60 0.53
61 0.51
62 0.52
63 0.5
64 0.55
65 0.57
66 0.58
67 0.52
68 0.52
69 0.54
70 0.56
71 0.54
72 0.56
73 0.56
74 0.55
75 0.6
76 0.61
77 0.6
78 0.59
79 0.62
80 0.57
81 0.55
82 0.51
83 0.48
84 0.48
85 0.5
86 0.51
87 0.54
88 0.59
89 0.62
90 0.68
91 0.69
92 0.71
93 0.71
94 0.71
95 0.67
96 0.61
97 0.59
98 0.55
99 0.52
100 0.45
101 0.47
102 0.43
103 0.4
104 0.35
105 0.28
106 0.25
107 0.24
108 0.25
109 0.26
110 0.28
111 0.28
112 0.29
113 0.3
114 0.27
115 0.29
116 0.31
117 0.25
118 0.26
119 0.26
120 0.3
121 0.3
122 0.28
123 0.25
124 0.21
125 0.18
126 0.19
127 0.23
128 0.28
129 0.33
130 0.39
131 0.44
132 0.5
133 0.52
134 0.57
135 0.6
136 0.57
137 0.57
138 0.56
139 0.56
140 0.53
141 0.55
142 0.48
143 0.42
144 0.38
145 0.35
146 0.35
147 0.31
148 0.33
149 0.29
150 0.29
151 0.27
152 0.26
153 0.24
154 0.25
155 0.24
156 0.23
157 0.28
158 0.31
159 0.33
160 0.4
161 0.41
162 0.42
163 0.45
164 0.44
165 0.41
166 0.38
167 0.35
168 0.28
169 0.24
170 0.19
171 0.14
172 0.11
173 0.09
174 0.08
175 0.08
176 0.08
177 0.07
178 0.07
179 0.07
180 0.07
181 0.07
182 0.09
183 0.12
184 0.18
185 0.26
186 0.34
187 0.4
188 0.41
189 0.44
190 0.5
191 0.56
192 0.57
193 0.52
194 0.52
195 0.47