Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2T9YSN3

Protein Details
Accession A0A2T9YSN3    Localization Confidence Medium Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
43-64YTLCVKDKKKAEKLRQSFPPGLHydrophilic
NLS Segment(s)
PositionSequence
21-28RSVKVKKN
Subcellular Location(s) nucl 15, cyto_nucl 12, cyto 7, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR002675  Ribosomal_L38e  
IPR038464  Ribosomal_L38e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01781  Ribosomal_L38e  
Amino Acid Sequences MAKQITDIKNFLEVTRRKDARSVKVKKNGDKIKFKVRCSRYLYTLCVKDKKKAEKLRQSFPPGLAVTDI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.43
3 0.43
4 0.39
5 0.45
6 0.52
7 0.52
8 0.59
9 0.61
10 0.6
11 0.68
12 0.74
13 0.74
14 0.77
15 0.75
16 0.73
17 0.73
18 0.68
19 0.69
20 0.69
21 0.65
22 0.65
23 0.6
24 0.6
25 0.58
26 0.57
27 0.52
28 0.5
29 0.5
30 0.47
31 0.5
32 0.47
33 0.48
34 0.47
35 0.48
36 0.53
37 0.59
38 0.62
39 0.66
40 0.72
41 0.75
42 0.8
43 0.81
44 0.82
45 0.8
46 0.74
47 0.65
48 0.61
49 0.5