Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T9YDJ1

Protein Details
Accession A0A2T9YDJ1   
Localization Confidence Low
Confidence Score 7.4
NoLS Segment(s)
PositionSequenceProtein Nature
131-160YENTVFKRRSAKDRKTSTRRTNLNPEKINKHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 10, mito 7, nucl 6, E.R. 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MGDNILQIPVKTRSVNSNNTSTKSIILNIPDSSINSEDISVKLAQENDLEAQAIMRYVAGRIKSTNNKFYIINMVCLFVIFITVLCVSLIAKSLQKKYKLIIICITVPTFILFMIFNFYIKSRRVKKLVEYENTVFKRRSAKDRKTSTRRTNLNPEKINKGGNTYLYKERA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.46
3 0.45
4 0.51
5 0.52
6 0.54
7 0.55
8 0.46
9 0.41
10 0.34
11 0.32
12 0.25
13 0.24
14 0.23
15 0.21
16 0.22
17 0.2
18 0.19
19 0.2
20 0.18
21 0.16
22 0.14
23 0.14
24 0.14
25 0.13
26 0.15
27 0.12
28 0.11
29 0.12
30 0.12
31 0.12
32 0.11
33 0.13
34 0.11
35 0.11
36 0.11
37 0.08
38 0.08
39 0.07
40 0.07
41 0.05
42 0.04
43 0.04
44 0.05
45 0.08
46 0.08
47 0.1
48 0.11
49 0.18
50 0.27
51 0.32
52 0.38
53 0.37
54 0.38
55 0.37
56 0.36
57 0.39
58 0.3
59 0.28
60 0.22
61 0.21
62 0.18
63 0.18
64 0.17
65 0.07
66 0.07
67 0.04
68 0.03
69 0.04
70 0.04
71 0.04
72 0.04
73 0.04
74 0.04
75 0.04
76 0.05
77 0.05
78 0.08
79 0.11
80 0.18
81 0.23
82 0.25
83 0.26
84 0.26
85 0.32
86 0.31
87 0.3
88 0.27
89 0.24
90 0.23
91 0.23
92 0.22
93 0.16
94 0.14
95 0.12
96 0.09
97 0.07
98 0.06
99 0.05
100 0.05
101 0.09
102 0.09
103 0.09
104 0.09
105 0.11
106 0.14
107 0.16
108 0.25
109 0.29
110 0.36
111 0.41
112 0.44
113 0.51
114 0.58
115 0.64
116 0.61
117 0.6
118 0.56
119 0.6
120 0.59
121 0.55
122 0.45
123 0.39
124 0.43
125 0.41
126 0.49
127 0.51
128 0.58
129 0.65
130 0.75
131 0.83
132 0.84
133 0.9
134 0.89
135 0.89
136 0.86
137 0.84
138 0.85
139 0.84
140 0.84
141 0.81
142 0.76
143 0.73
144 0.68
145 0.65
146 0.55
147 0.5
148 0.44
149 0.43
150 0.43
151 0.41