Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T9YBZ3

Protein Details
Accession A0A2T9YBZ3    Localization Confidence Medium Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MTVKRRNHGRNKKGRGNVTSIHydrophilic
91-114GRRIRTPPPRVRFNKDGKKINPNSHydrophilic
NLS Segment(s)
PositionSequence
5-14RRNHGRNKKG
Subcellular Location(s) mito_nucl 12, nucl 11.5, mito 11.5, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR000892  Ribosomal_S26e  
IPR038551  Ribosomal_S26e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01283  Ribosomal_S26e  
PROSITE View protein in PROSITE  
PS00733  RIBOSOMAL_S26E  
Amino Acid Sequences MTVKRRNHGRNKKGRGNVTSIRCDNCSRCCPKDKAIKRFTVRNMVEAAAQRDMAEASVYESYALPKLYIKVHYCVACAIHNHIVRVRSTVGRRIRTPPPRVRFNKDGKKINPNSAVAQNA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.87
2 0.8
3 0.77
4 0.75
5 0.7
6 0.69
7 0.62
8 0.56
9 0.51
10 0.5
11 0.46
12 0.45
13 0.47
14 0.46
15 0.48
16 0.53
17 0.54
18 0.58
19 0.65
20 0.68
21 0.69
22 0.7
23 0.73
24 0.7
25 0.73
26 0.69
27 0.68
28 0.59
29 0.5
30 0.44
31 0.36
32 0.34
33 0.28
34 0.26
35 0.16
36 0.15
37 0.13
38 0.12
39 0.11
40 0.09
41 0.07
42 0.04
43 0.05
44 0.05
45 0.05
46 0.05
47 0.05
48 0.06
49 0.07
50 0.07
51 0.06
52 0.06
53 0.08
54 0.1
55 0.15
56 0.16
57 0.17
58 0.21
59 0.21
60 0.21
61 0.2
62 0.2
63 0.17
64 0.16
65 0.18
66 0.21
67 0.22
68 0.23
69 0.24
70 0.25
71 0.23
72 0.25
73 0.24
74 0.22
75 0.24
76 0.32
77 0.37
78 0.41
79 0.43
80 0.47
81 0.54
82 0.58
83 0.65
84 0.67
85 0.67
86 0.72
87 0.76
88 0.79
89 0.78
90 0.8
91 0.81
92 0.8
93 0.82
94 0.78
95 0.82
96 0.79
97 0.78
98 0.75
99 0.67
100 0.62