Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T9Y9I5

Protein Details
Accession A0A2T9Y9I5   
Localization Confidence Medium
Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
33-52KYEHPARRSRRSKLKSQSTYHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 23.5, cyto_nucl 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR037817  TAF7  
IPR006751  TAFII55_prot_cons_reg  
Gene Ontology GO:0005669  C:transcription factor TFIID complex  
GO:0006367  P:transcription initiation at RNA polymerase II promoter  
Pfam View protein in Pfam  
PF04658  TAFII55_N  
Amino Acid Sequences MEYQEKSTQNQNDLPSEPSKTPKITLKVNPVDKYEHPARRSRRSKLKSQSTYQEDYDWELTEERRESKQYDDDFYTENSQHENQNTSLLAELQDSRLIPEKHFIIRVPEEIVDNVRQAIVDKATKSRIDITFINNRKAAFRLDQKFYSARLVDLPTITESYKIFDKKQLLKVADISQVRIYXK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.38
3 0.37
4 0.34
5 0.34
6 0.35
7 0.33
8 0.36
9 0.4
10 0.42
11 0.46
12 0.51
13 0.56
14 0.6
15 0.66
16 0.64
17 0.59
18 0.59
19 0.51
20 0.52
21 0.51
22 0.49
23 0.45
24 0.5
25 0.56
26 0.61
27 0.68
28 0.7
29 0.72
30 0.7
31 0.77
32 0.79
33 0.82
34 0.79
35 0.77
36 0.77
37 0.72
38 0.7
39 0.61
40 0.52
41 0.41
42 0.37
43 0.33
44 0.24
45 0.18
46 0.15
47 0.14
48 0.15
49 0.17
50 0.16
51 0.17
52 0.18
53 0.19
54 0.22
55 0.29
56 0.28
57 0.29
58 0.29
59 0.28
60 0.27
61 0.27
62 0.26
63 0.19
64 0.18
65 0.16
66 0.16
67 0.17
68 0.16
69 0.17
70 0.15
71 0.15
72 0.15
73 0.13
74 0.12
75 0.1
76 0.09
77 0.07
78 0.07
79 0.06
80 0.07
81 0.07
82 0.07
83 0.14
84 0.14
85 0.14
86 0.16
87 0.17
88 0.18
89 0.19
90 0.19
91 0.17
92 0.18
93 0.19
94 0.18
95 0.16
96 0.16
97 0.15
98 0.17
99 0.13
100 0.11
101 0.1
102 0.09
103 0.08
104 0.08
105 0.09
106 0.1
107 0.12
108 0.13
109 0.15
110 0.19
111 0.19
112 0.2
113 0.25
114 0.23
115 0.25
116 0.26
117 0.29
118 0.35
119 0.39
120 0.41
121 0.36
122 0.36
123 0.33
124 0.33
125 0.31
126 0.28
127 0.34
128 0.36
129 0.4
130 0.41
131 0.43
132 0.43
133 0.41
134 0.41
135 0.32
136 0.26
137 0.24
138 0.25
139 0.23
140 0.22
141 0.21
142 0.17
143 0.18
144 0.18
145 0.16
146 0.14
147 0.16
148 0.22
149 0.24
150 0.24
151 0.29
152 0.38
153 0.44
154 0.52
155 0.57
156 0.53
157 0.53
158 0.56
159 0.53
160 0.52
161 0.45
162 0.4