Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T9YPW7

Protein Details
Accession A0A2T9YPW7   
Localization Confidence Medium
Confidence Score 13.8
NoLS Segment(s)
PositionSequenceProtein Nature
391-464RGMNRSRERYRDNKESRNKSKERYRDIYRDRSRERYRDRSRERYRDRSREKYRDRSREKYRDKDENRNKDRYRABasic
NLS Segment(s)
PositionSequence
395-461RSRERYRDNKESRNKSKERYRDIYRDRSRERYRDRSRERYRDRSREKYRDRSREKYRDKDENRNKDR
Subcellular Location(s) nucl 21.5, cyto_nucl 11.5, mito 2, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR036915  Cyclin-like_sf  
IPR043198  Cyclin/Ssn8  
Gene Ontology GO:0016538  F:cyclin-dependent protein serine/threonine kinase regulator activity  
GO:0006357  P:regulation of transcription by RNA polymerase II  
CDD cd20533  CYCLIN_CCNL_rpt2  
Amino Acid Sequences MPEYNIPNNNSNTLATLEMITNSPSRKNFLTLETEDSLREYGCLLIQSSGILMKLPQVVMASAAVLFQRDAVMGCLLLATKTEESLRRVRDIILTVDITIKYHRGFPLRILDCSSHEYLDYKDSITVAEMKILRSLGFNVQVQLPYGLLINYLQCLEIATQEKLSQTAWNYLNDSLKTKLYICFQVNTIACAAIYTVCEEMRIKLPSNPAWYEIFDVDRSDLICASNIIKDMYSKKICTIFPVSQKETELYLSNKLNSHVLREKELLIKSQLLLKQLTIKSEFVSDTKNLNKDYIDNDSQKKNGDFMNTSEHKYDENKSDTRLNSQNSNSKNAQNLVNKETYSSRKSDFSQENEYKSNSLKDYSKSQSNHYHTIKDKSIGLQENASIEKNRGMNRSRERYRDNKESRNKSKERYRDIYRDRSRERYRDRSRERYRDRSREKYRDRSREKYRDKDENRNKDRYRA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.18
3 0.17
4 0.15
5 0.14
6 0.14
7 0.15
8 0.16
9 0.18
10 0.23
11 0.23
12 0.27
13 0.28
14 0.32
15 0.33
16 0.35
17 0.4
18 0.37
19 0.42
20 0.4
21 0.38
22 0.34
23 0.32
24 0.28
25 0.2
26 0.17
27 0.12
28 0.1
29 0.11
30 0.12
31 0.11
32 0.11
33 0.11
34 0.11
35 0.11
36 0.11
37 0.09
38 0.08
39 0.07
40 0.1
41 0.13
42 0.12
43 0.13
44 0.12
45 0.12
46 0.13
47 0.13
48 0.1
49 0.07
50 0.08
51 0.07
52 0.07
53 0.07
54 0.06
55 0.07
56 0.06
57 0.07
58 0.08
59 0.08
60 0.07
61 0.07
62 0.07
63 0.07
64 0.07
65 0.07
66 0.09
67 0.09
68 0.1
69 0.14
70 0.17
71 0.22
72 0.29
73 0.32
74 0.32
75 0.32
76 0.33
77 0.33
78 0.32
79 0.3
80 0.26
81 0.23
82 0.2
83 0.22
84 0.21
85 0.18
86 0.16
87 0.16
88 0.14
89 0.17
90 0.2
91 0.22
92 0.23
93 0.27
94 0.36
95 0.36
96 0.37
97 0.36
98 0.34
99 0.32
100 0.36
101 0.32
102 0.22
103 0.2
104 0.2
105 0.18
106 0.2
107 0.18
108 0.14
109 0.13
110 0.13
111 0.13
112 0.13
113 0.14
114 0.11
115 0.15
116 0.15
117 0.15
118 0.17
119 0.17
120 0.16
121 0.14
122 0.16
123 0.14
124 0.17
125 0.17
126 0.16
127 0.17
128 0.17
129 0.17
130 0.16
131 0.12
132 0.09
133 0.09
134 0.07
135 0.06
136 0.06
137 0.06
138 0.06
139 0.06
140 0.06
141 0.05
142 0.06
143 0.06
144 0.09
145 0.12
146 0.12
147 0.13
148 0.14
149 0.14
150 0.14
151 0.14
152 0.13
153 0.12
154 0.18
155 0.2
156 0.2
157 0.22
158 0.23
159 0.26
160 0.24
161 0.25
162 0.2
163 0.19
164 0.19
165 0.18
166 0.19
167 0.18
168 0.23
169 0.22
170 0.21
171 0.21
172 0.27
173 0.25
174 0.24
175 0.21
176 0.15
177 0.13
178 0.12
179 0.11
180 0.05
181 0.06
182 0.06
183 0.06
184 0.06
185 0.07
186 0.07
187 0.09
188 0.12
189 0.14
190 0.14
191 0.17
192 0.21
193 0.23
194 0.27
195 0.27
196 0.24
197 0.24
198 0.23
199 0.22
200 0.19
201 0.17
202 0.12
203 0.12
204 0.1
205 0.09
206 0.09
207 0.08
208 0.07
209 0.06
210 0.06
211 0.06
212 0.07
213 0.07
214 0.07
215 0.07
216 0.07
217 0.09
218 0.11
219 0.17
220 0.18
221 0.18
222 0.2
223 0.24
224 0.24
225 0.26
226 0.29
227 0.27
228 0.33
229 0.39
230 0.39
231 0.35
232 0.36
233 0.33
234 0.28
235 0.24
236 0.19
237 0.14
238 0.17
239 0.17
240 0.18
241 0.18
242 0.18
243 0.2
244 0.18
245 0.22
246 0.24
247 0.24
248 0.25
249 0.26
250 0.27
251 0.28
252 0.29
253 0.25
254 0.21
255 0.2
256 0.18
257 0.21
258 0.21
259 0.18
260 0.17
261 0.16
262 0.22
263 0.22
264 0.25
265 0.22
266 0.21
267 0.19
268 0.21
269 0.21
270 0.14
271 0.16
272 0.15
273 0.17
274 0.21
275 0.24
276 0.23
277 0.23
278 0.23
279 0.21
280 0.23
281 0.25
282 0.26
283 0.27
284 0.31
285 0.32
286 0.33
287 0.34
288 0.32
289 0.27
290 0.24
291 0.24
292 0.22
293 0.21
294 0.29
295 0.28
296 0.3
297 0.29
298 0.27
299 0.25
300 0.26
301 0.28
302 0.26
303 0.29
304 0.29
305 0.3
306 0.36
307 0.35
308 0.39
309 0.41
310 0.37
311 0.38
312 0.41
313 0.45
314 0.41
315 0.46
316 0.43
317 0.4
318 0.41
319 0.37
320 0.4
321 0.4
322 0.41
323 0.4
324 0.4
325 0.37
326 0.35
327 0.37
328 0.35
329 0.32
330 0.31
331 0.29
332 0.3
333 0.33
334 0.4
335 0.41
336 0.41
337 0.48
338 0.49
339 0.51
340 0.5
341 0.49
342 0.42
343 0.38
344 0.36
345 0.28
346 0.27
347 0.27
348 0.27
349 0.34
350 0.37
351 0.43
352 0.41
353 0.46
354 0.52
355 0.54
356 0.6
357 0.55
358 0.57
359 0.54
360 0.59
361 0.56
362 0.49
363 0.45
364 0.39
365 0.43
366 0.4
367 0.37
368 0.32
369 0.29
370 0.29
371 0.29
372 0.27
373 0.21
374 0.18
375 0.21
376 0.24
377 0.27
378 0.32
379 0.35
380 0.42
381 0.51
382 0.6
383 0.63
384 0.67
385 0.7
386 0.73
387 0.77
388 0.78
389 0.77
390 0.77
391 0.81
392 0.84
393 0.86
394 0.87
395 0.85
396 0.83
397 0.85
398 0.84
399 0.83
400 0.81
401 0.8
402 0.8
403 0.82
404 0.84
405 0.83
406 0.84
407 0.8
408 0.82
409 0.83
410 0.82
411 0.83
412 0.83
413 0.84
414 0.85
415 0.88
416 0.89
417 0.9
418 0.91
419 0.91
420 0.91
421 0.91
422 0.91
423 0.91
424 0.91
425 0.91
426 0.91
427 0.92
428 0.92
429 0.92
430 0.92
431 0.91
432 0.9
433 0.91
434 0.91
435 0.91
436 0.9
437 0.89
438 0.89
439 0.88
440 0.89
441 0.89
442 0.89
443 0.87
444 0.87