Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T9Z028

Protein Details
Accession A0A2T9Z028    Localization Confidence Low Confidence Score 7.3
NoLS Segment(s)
PositionSequenceProtein Nature
39-58IDCLNKSKSKKSQHNPTINWHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 10, cyto_nucl 9, nucl 8, cyto 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR036875  Znf_CCHC_sf  
Gene Ontology GO:0003676  F:nucleic acid binding  
GO:0008270  F:zinc ion binding  
Amino Acid Sequences MAIDTVIPIRRGGFSTVEKDCRRNLGLCLYCGQPAHIAIDCLNKSKSKKSQHNPTINWTTSTLKFKSQYCSANCNPILVPVNATFAYTSEEEKTNTPTLAEDTEEYYSAKKESLPINQSVVVPLADNKIKTLHGTQELLKSVLAHSIAQYKKFADPRHTTNTFSDGLIEPPQPDIIEGGLELKVNQVLDSKLKY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.29
3 0.35
4 0.43
5 0.44
6 0.45
7 0.46
8 0.46
9 0.45
10 0.41
11 0.38
12 0.39
13 0.4
14 0.38
15 0.37
16 0.33
17 0.31
18 0.29
19 0.27
20 0.18
21 0.16
22 0.17
23 0.15
24 0.15
25 0.14
26 0.21
27 0.21
28 0.22
29 0.24
30 0.25
31 0.28
32 0.36
33 0.44
34 0.47
35 0.57
36 0.63
37 0.73
38 0.78
39 0.85
40 0.79
41 0.78
42 0.76
43 0.66
44 0.58
45 0.49
46 0.43
47 0.38
48 0.4
49 0.33
50 0.3
51 0.32
52 0.32
53 0.35
54 0.37
55 0.39
56 0.37
57 0.44
58 0.4
59 0.45
60 0.43
61 0.39
62 0.33
63 0.3
64 0.29
65 0.21
66 0.22
67 0.14
68 0.16
69 0.15
70 0.15
71 0.11
72 0.09
73 0.11
74 0.1
75 0.11
76 0.1
77 0.11
78 0.12
79 0.13
80 0.16
81 0.14
82 0.14
83 0.13
84 0.11
85 0.11
86 0.11
87 0.11
88 0.08
89 0.09
90 0.09
91 0.1
92 0.09
93 0.09
94 0.09
95 0.09
96 0.08
97 0.07
98 0.1
99 0.14
100 0.2
101 0.23
102 0.24
103 0.25
104 0.26
105 0.26
106 0.23
107 0.2
108 0.13
109 0.1
110 0.1
111 0.11
112 0.11
113 0.11
114 0.11
115 0.12
116 0.12
117 0.14
118 0.15
119 0.17
120 0.19
121 0.21
122 0.22
123 0.25
124 0.26
125 0.25
126 0.23
127 0.19
128 0.15
129 0.16
130 0.15
131 0.1
132 0.1
133 0.18
134 0.19
135 0.21
136 0.22
137 0.21
138 0.27
139 0.32
140 0.35
141 0.36
142 0.41
143 0.46
144 0.54
145 0.54
146 0.51
147 0.48
148 0.48
149 0.4
150 0.34
151 0.3
152 0.22
153 0.22
154 0.22
155 0.21
156 0.17
157 0.17
158 0.18
159 0.15
160 0.14
161 0.12
162 0.1
163 0.09
164 0.08
165 0.09
166 0.09
167 0.09
168 0.08
169 0.09
170 0.1
171 0.1
172 0.11
173 0.12
174 0.14