Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T9YZR4

Protein Details
Accession A0A2T9YZR4    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
77-96YMKYLTKKFLKKNQLRDWIRHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14.5, mito_nucl 12.5, mito 9.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR002671  Ribosomal_L22e  
IPR038526  Ribosomal_L22e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01776  Ribosomal_L22e  
Amino Acid Sequences MAVIKSKTQPKKLWGRFEIDASIPAADNIFDIPLFEKYLHDRIKINGIAGKLGTDVIITRNKNTLKITSKVDMSKRYMKYLTKKFLKKNQLRDWIRVVADNKGSYQLKYYNINQEVTA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.71
2 0.69
3 0.63
4 0.6
5 0.53
6 0.43
7 0.36
8 0.26
9 0.23
10 0.16
11 0.14
12 0.11
13 0.08
14 0.07
15 0.06
16 0.06
17 0.05
18 0.05
19 0.07
20 0.08
21 0.09
22 0.09
23 0.1
24 0.13
25 0.22
26 0.23
27 0.24
28 0.24
29 0.24
30 0.31
31 0.3
32 0.27
33 0.22
34 0.2
35 0.18
36 0.17
37 0.15
38 0.09
39 0.08
40 0.07
41 0.04
42 0.04
43 0.07
44 0.12
45 0.12
46 0.13
47 0.18
48 0.19
49 0.21
50 0.23
51 0.26
52 0.26
53 0.29
54 0.32
55 0.29
56 0.32
57 0.34
58 0.36
59 0.35
60 0.35
61 0.41
62 0.38
63 0.4
64 0.41
65 0.43
66 0.49
67 0.53
68 0.58
69 0.58
70 0.64
71 0.69
72 0.74
73 0.79
74 0.78
75 0.79
76 0.79
77 0.81
78 0.78
79 0.74
80 0.7
81 0.64
82 0.57
83 0.52
84 0.43
85 0.38
86 0.39
87 0.35
88 0.3
89 0.32
90 0.33
91 0.27
92 0.3
93 0.29
94 0.29
95 0.34
96 0.38
97 0.41
98 0.43