Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2T9YV89

Protein Details
Accession A0A2T9YV89    Localization Confidence Medium Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-30MAPVPKSSSKTKKKWSKGKTKDKVNNAITFHydrophilic
NLS Segment(s)
PositionSequence
9-21SKTKKKWSKGKTK
Subcellular Location(s) nucl 9.5mito_nucl 9.5, mito 8.5, cyto 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MAPVPKSSSKTKKKWSKGKTKDKVNNAITFDATTLEKVKKEIPAYKLITPSVLVDRLRINGSLARKALSELHQMGSIKLISAHGSQMIYTRAIVASADDEPVVEVVTKKGKKN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.89
2 0.9
3 0.9
4 0.91
5 0.93
6 0.92
7 0.92
8 0.9
9 0.89
10 0.88
11 0.82
12 0.77
13 0.69
14 0.6
15 0.5
16 0.41
17 0.32
18 0.23
19 0.18
20 0.13
21 0.13
22 0.13
23 0.13
24 0.14
25 0.16
26 0.19
27 0.23
28 0.28
29 0.28
30 0.34
31 0.37
32 0.38
33 0.38
34 0.34
35 0.3
36 0.24
37 0.22
38 0.16
39 0.16
40 0.13
41 0.12
42 0.13
43 0.14
44 0.14
45 0.13
46 0.12
47 0.12
48 0.14
49 0.16
50 0.16
51 0.15
52 0.14
53 0.15
54 0.17
55 0.16
56 0.19
57 0.17
58 0.18
59 0.2
60 0.2
61 0.19
62 0.18
63 0.16
64 0.11
65 0.1
66 0.1
67 0.09
68 0.09
69 0.1
70 0.1
71 0.1
72 0.1
73 0.12
74 0.13
75 0.11
76 0.11
77 0.11
78 0.09
79 0.09
80 0.09
81 0.08
82 0.09
83 0.09
84 0.09
85 0.08
86 0.08
87 0.08
88 0.09
89 0.08
90 0.07
91 0.07
92 0.1
93 0.2