Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T9YVJ6

Protein Details
Accession A0A2T9YVJ6   
Localization Confidence High
Confidence Score 20.2
NoLS Segment(s)
PositionSequenceProtein Nature
72-99ESITDNQKNKKSKKNKNKKNQNKEDEFIHydrophilic
202-227KKASKNSVIKPLKKKISKNYKVWTEVHydrophilic
NLS Segment(s)
PositionSequence
79-90KNKKSKKNKNKK
195-222WKTSKDLKKASKNSVIKPLKKKISKNYK
229-244KGEQKNEEHKKKKIKK
Subcellular Location(s) nucl 22.5, cyto_nucl 12.5, cyto 1.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR018034  Kri1  
IPR024626  Kri1-like_C  
Pfam View protein in Pfam  
PF05178  Kri1  
PF12936  Kri1_C  
Amino Acid Sequences MEEIMKKIEKIKEVTGNSSVGFDSIDLDGDYDPDAYDKQMETIFNEDYYQTQDKKKPTWDDDLDISDIIKPESITDNQKNKKSKKNKNKKNQNKEDEFIMDADYLLKNQIEDSGVSGVNVNAEISDEKKQLSKSIEQYYQLNYEDIIDDLPTRFKYQKSKSFDFGLTPEEILLADEKDLNDLVSVKKLAPFRPEWKTSKDLKKASKNSVIKPLKKKISKNYKVWTEVFKGEQKNEEHKKKKIKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.51
2 0.47
3 0.43
4 0.38
5 0.35
6 0.27
7 0.19
8 0.16
9 0.11
10 0.1
11 0.08
12 0.09
13 0.08
14 0.09
15 0.08
16 0.09
17 0.09
18 0.08
19 0.07
20 0.07
21 0.08
22 0.08
23 0.1
24 0.09
25 0.11
26 0.13
27 0.13
28 0.14
29 0.18
30 0.18
31 0.16
32 0.17
33 0.15
34 0.14
35 0.19
36 0.22
37 0.21
38 0.27
39 0.32
40 0.37
41 0.42
42 0.49
43 0.52
44 0.52
45 0.58
46 0.55
47 0.53
48 0.51
49 0.48
50 0.41
51 0.33
52 0.28
53 0.2
54 0.17
55 0.13
56 0.11
57 0.08
58 0.08
59 0.12
60 0.14
61 0.21
62 0.29
63 0.38
64 0.44
65 0.51
66 0.59
67 0.62
68 0.7
69 0.73
70 0.76
71 0.78
72 0.83
73 0.87
74 0.89
75 0.94
76 0.95
77 0.95
78 0.95
79 0.93
80 0.87
81 0.78
82 0.7
83 0.6
84 0.49
85 0.38
86 0.28
87 0.18
88 0.12
89 0.11
90 0.08
91 0.07
92 0.07
93 0.06
94 0.05
95 0.05
96 0.06
97 0.06
98 0.06
99 0.07
100 0.08
101 0.08
102 0.08
103 0.08
104 0.07
105 0.06
106 0.06
107 0.05
108 0.03
109 0.04
110 0.04
111 0.06
112 0.08
113 0.09
114 0.09
115 0.12
116 0.12
117 0.15
118 0.18
119 0.21
120 0.25
121 0.3
122 0.32
123 0.31
124 0.33
125 0.31
126 0.3
127 0.26
128 0.21
129 0.15
130 0.13
131 0.12
132 0.1
133 0.08
134 0.06
135 0.06
136 0.06
137 0.08
138 0.08
139 0.11
140 0.13
141 0.16
142 0.26
143 0.34
144 0.42
145 0.49
146 0.52
147 0.53
148 0.55
149 0.53
150 0.45
151 0.38
152 0.32
153 0.24
154 0.2
155 0.16
156 0.12
157 0.11
158 0.09
159 0.09
160 0.06
161 0.06
162 0.07
163 0.07
164 0.08
165 0.08
166 0.07
167 0.07
168 0.08
169 0.09
170 0.11
171 0.12
172 0.11
173 0.16
174 0.19
175 0.21
176 0.26
177 0.31
178 0.35
179 0.42
180 0.49
181 0.49
182 0.51
183 0.55
184 0.59
185 0.63
186 0.65
187 0.66
188 0.69
189 0.75
190 0.77
191 0.79
192 0.8
193 0.76
194 0.72
195 0.75
196 0.75
197 0.73
198 0.75
199 0.76
200 0.76
201 0.77
202 0.81
203 0.81
204 0.83
205 0.83
206 0.83
207 0.83
208 0.82
209 0.8
210 0.75
211 0.7
212 0.64
213 0.59
214 0.55
215 0.52
216 0.49
217 0.46
218 0.49
219 0.49
220 0.54
221 0.6
222 0.66
223 0.67
224 0.71