Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T9YEB8

Protein Details
Accession A0A2T9YEB8    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
29-56ILKTSRSVKKKSRKLKKLSANAHKRQVNHydrophilic
NLS Segment(s)
PositionSequence
34-49RSVKKKSRKLKKLSAN
Subcellular Location(s) mito 17, extr 6, pero 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MDLIVAPKYRTLLYGLTSVVLGYFSISAILKTSRSVKKKSRKLKKLSANAHKRQVNQPTASTGNSFFYPKYKPWVQLG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.17
3 0.15
4 0.15
5 0.13
6 0.11
7 0.09
8 0.06
9 0.05
10 0.04
11 0.04
12 0.05
13 0.05
14 0.05
15 0.06
16 0.07
17 0.07
18 0.09
19 0.17
20 0.23
21 0.28
22 0.34
23 0.43
24 0.52
25 0.62
26 0.71
27 0.74
28 0.77
29 0.81
30 0.84
31 0.84
32 0.84
33 0.84
34 0.84
35 0.84
36 0.8
37 0.8
38 0.75
39 0.68
40 0.66
41 0.65
42 0.61
43 0.53
44 0.48
45 0.45
46 0.43
47 0.4
48 0.34
49 0.27
50 0.23
51 0.22
52 0.22
53 0.17
54 0.19
55 0.22
56 0.23
57 0.3
58 0.33