Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T9YA26

Protein Details
Accession A0A2T9YA26    Localization Confidence Low Confidence Score 8.7
NoLS Segment(s)
PositionSequenceProtein Nature
382-404TSDCCARLKRILTKKTFNRNLLDHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13.5, cyto_nucl 10.5, cyto 6.5, mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR033468  Metaxin_GST  
IPR019564  Sam37/metaxin_N  
Gene Ontology GO:0001401  C:SAM complex  
GO:0015031  P:protein transport  
Pfam View protein in Pfam  
PF17171  GST_C_6  
PF10568  Tom37  
Amino Acid Sequences MLTLNSFPLIKFPAAEPTFIPKKDTLWMYSGENSKTPSFDLDFFVTTEPDSSPNTKLPFFMSSDGTVQTKNQTISKFKQLQETQNHAHNLELDAMLILVKNTIKQAIKLELWSNYENYKNYTMPLYSANKSSIFGALVNNGNRNQILYDLKIKNSLFFNENDHSINIVSPLYYLVNMLTLNSFPLIKFPAAEPTFIPKKDTLWMYSGENSKTPSFDLDFFVTTEPDSSPNTKLPFFMSSDGTVQTKNQTISKFKQLQETQNHAHNLELDAMLILVENTIKQAIKLELWSNYENYKNYTMPLYSANKSSIFGALVNNGNRNQILYDLKIKNSLFFNENDIFDEAEECLIALSDYLEDHQFFSMEDCPGYLDAVVFSCTHIIMTSDCCARLKRILTKKTFNRNLLDHEKNIFKLYY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.28
3 0.26
4 0.32
5 0.38
6 0.38
7 0.41
8 0.31
9 0.33
10 0.39
11 0.41
12 0.35
13 0.31
14 0.33
15 0.33
16 0.38
17 0.41
18 0.36
19 0.34
20 0.34
21 0.33
22 0.31
23 0.28
24 0.26
25 0.24
26 0.24
27 0.26
28 0.25
29 0.25
30 0.24
31 0.24
32 0.2
33 0.17
34 0.17
35 0.14
36 0.13
37 0.16
38 0.18
39 0.2
40 0.25
41 0.28
42 0.27
43 0.28
44 0.28
45 0.28
46 0.28
47 0.27
48 0.25
49 0.23
50 0.25
51 0.26
52 0.24
53 0.21
54 0.19
55 0.21
56 0.22
57 0.23
58 0.25
59 0.28
60 0.34
61 0.38
62 0.47
63 0.51
64 0.49
65 0.57
66 0.58
67 0.62
68 0.64
69 0.66
70 0.6
71 0.59
72 0.59
73 0.49
74 0.44
75 0.36
76 0.29
77 0.23
78 0.19
79 0.12
80 0.1
81 0.09
82 0.09
83 0.07
84 0.06
85 0.05
86 0.06
87 0.07
88 0.08
89 0.13
90 0.14
91 0.16
92 0.19
93 0.23
94 0.24
95 0.26
96 0.27
97 0.26
98 0.29
99 0.28
100 0.26
101 0.24
102 0.27
103 0.25
104 0.26
105 0.26
106 0.23
107 0.22
108 0.23
109 0.21
110 0.18
111 0.23
112 0.24
113 0.23
114 0.24
115 0.25
116 0.24
117 0.24
118 0.23
119 0.18
120 0.14
121 0.13
122 0.11
123 0.13
124 0.16
125 0.17
126 0.19
127 0.18
128 0.19
129 0.18
130 0.17
131 0.14
132 0.13
133 0.14
134 0.14
135 0.22
136 0.23
137 0.24
138 0.29
139 0.28
140 0.28
141 0.28
142 0.28
143 0.21
144 0.2
145 0.25
146 0.21
147 0.23
148 0.21
149 0.19
150 0.18
151 0.16
152 0.15
153 0.1
154 0.09
155 0.07
156 0.06
157 0.06
158 0.06
159 0.06
160 0.06
161 0.05
162 0.06
163 0.06
164 0.06
165 0.05
166 0.05
167 0.05
168 0.06
169 0.06
170 0.05
171 0.09
172 0.12
173 0.13
174 0.14
175 0.16
176 0.26
177 0.27
178 0.28
179 0.26
180 0.32
181 0.38
182 0.38
183 0.41
184 0.31
185 0.33
186 0.39
187 0.41
188 0.35
189 0.31
190 0.33
191 0.33
192 0.38
193 0.41
194 0.36
195 0.34
196 0.34
197 0.33
198 0.31
199 0.28
200 0.26
201 0.24
202 0.24
203 0.26
204 0.25
205 0.25
206 0.24
207 0.24
208 0.2
209 0.17
210 0.17
211 0.14
212 0.13
213 0.16
214 0.18
215 0.2
216 0.25
217 0.28
218 0.27
219 0.28
220 0.28
221 0.28
222 0.28
223 0.27
224 0.25
225 0.23
226 0.25
227 0.26
228 0.24
229 0.21
230 0.19
231 0.21
232 0.22
233 0.23
234 0.25
235 0.28
236 0.34
237 0.38
238 0.47
239 0.51
240 0.49
241 0.57
242 0.58
243 0.62
244 0.64
245 0.66
246 0.6
247 0.59
248 0.59
249 0.49
250 0.44
251 0.36
252 0.29
253 0.23
254 0.19
255 0.12
256 0.1
257 0.09
258 0.08
259 0.07
260 0.05
261 0.03
262 0.03
263 0.03
264 0.03
265 0.05
266 0.05
267 0.05
268 0.08
269 0.09
270 0.1
271 0.13
272 0.16
273 0.18
274 0.22
275 0.23
276 0.22
277 0.24
278 0.27
279 0.25
280 0.26
281 0.26
282 0.23
283 0.22
284 0.23
285 0.21
286 0.18
287 0.23
288 0.24
289 0.23
290 0.24
291 0.25
292 0.24
293 0.24
294 0.23
295 0.18
296 0.14
297 0.13
298 0.11
299 0.13
300 0.16
301 0.17
302 0.19
303 0.18
304 0.19
305 0.18
306 0.17
307 0.14
308 0.13
309 0.14
310 0.14
311 0.22
312 0.23
313 0.24
314 0.29
315 0.28
316 0.28
317 0.28
318 0.28
319 0.21
320 0.2
321 0.26
322 0.24
323 0.25
324 0.24
325 0.24
326 0.22
327 0.2
328 0.2
329 0.14
330 0.1
331 0.09
332 0.06
333 0.05
334 0.05
335 0.05
336 0.04
337 0.04
338 0.04
339 0.05
340 0.06
341 0.08
342 0.09
343 0.1
344 0.1
345 0.1
346 0.1
347 0.12
348 0.14
349 0.14
350 0.13
351 0.12
352 0.13
353 0.13
354 0.14
355 0.11
356 0.08
357 0.08
358 0.09
359 0.1
360 0.09
361 0.09
362 0.09
363 0.09
364 0.09
365 0.08
366 0.09
367 0.09
368 0.12
369 0.16
370 0.17
371 0.19
372 0.21
373 0.23
374 0.26
375 0.32
376 0.36
377 0.42
378 0.5
379 0.59
380 0.66
381 0.74
382 0.8
383 0.84
384 0.86
385 0.82
386 0.79
387 0.73
388 0.74
389 0.73
390 0.69
391 0.62
392 0.58
393 0.57
394 0.51