Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T9YG54

Protein Details
Accession A0A2T9YG54    Localization Confidence Low Confidence Score 7.4
NoLS Segment(s)
PositionSequenceProtein Nature
48-72HSTRKYFRFPKKSHLEKKRFKNQANHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 14.5, mito_nucl 13.333, nucl 11, cyto_nucl 6.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR016197  Chromo-like_dom_sf  
Amino Acid Sequences MVYLNTTSNKAIYKRRYPIANHWLPFINEEIRNWQKTGVIKIAEVNTHSTRKYFRFPKKSHLEKKRFKNQANYDGPFKIHAKTERNNYALMNLDGELLTGTFDVIGLKPTSSDFEISKDIHVVKKNLDHKKIANKTFYFLKWKDLSDSKNS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.54
2 0.59
3 0.64
4 0.65
5 0.7
6 0.71
7 0.71
8 0.62
9 0.58
10 0.54
11 0.48
12 0.43
13 0.36
14 0.3
15 0.23
16 0.23
17 0.29
18 0.32
19 0.33
20 0.32
21 0.3
22 0.28
23 0.3
24 0.34
25 0.3
26 0.25
27 0.23
28 0.26
29 0.27
30 0.25
31 0.22
32 0.23
33 0.21
34 0.23
35 0.23
36 0.21
37 0.24
38 0.26
39 0.34
40 0.38
41 0.45
42 0.53
43 0.56
44 0.64
45 0.71
46 0.78
47 0.79
48 0.8
49 0.81
50 0.79
51 0.86
52 0.86
53 0.84
54 0.78
55 0.78
56 0.74
57 0.74
58 0.71
59 0.64
60 0.56
61 0.48
62 0.45
63 0.37
64 0.31
65 0.21
66 0.18
67 0.22
68 0.24
69 0.28
70 0.35
71 0.39
72 0.39
73 0.39
74 0.35
75 0.31
76 0.28
77 0.24
78 0.17
79 0.11
80 0.1
81 0.09
82 0.09
83 0.07
84 0.05
85 0.05
86 0.04
87 0.03
88 0.03
89 0.03
90 0.04
91 0.04
92 0.06
93 0.06
94 0.06
95 0.07
96 0.08
97 0.1
98 0.11
99 0.13
100 0.11
101 0.14
102 0.18
103 0.19
104 0.19
105 0.19
106 0.2
107 0.23
108 0.27
109 0.26
110 0.26
111 0.34
112 0.43
113 0.49
114 0.52
115 0.52
116 0.54
117 0.64
118 0.69
119 0.67
120 0.66
121 0.58
122 0.58
123 0.59
124 0.57
125 0.55
126 0.47
127 0.49
128 0.44
129 0.45
130 0.48
131 0.48