Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T9YVE4

Protein Details
Accession A0A2T9YVE4   
Localization Confidence Medium
Confidence Score 14.7
NoLS Segment(s)
PositionSequenceProtein Nature
8-36AIKAPLKLKHKSKTKSKRKRRIADEEGFTBasic
69-91TESEKRFKKTQEKRREERINQFIHydrophilic
NLS Segment(s)
PositionSequence
10-28KAPLKLKHKSKTKSKRKRR
Subcellular Location(s) nucl 17, cyto_nucl 10, mito 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR013865  FAM32A  
Amino Acid Sequences MSEYNIGAIKAPLKLKHKSKTKSKRKRRIADEEGFTQELISGNTLPNVPALKNEIDSPSLSGDSSSTLTESEKRFKKTQEKRREERINQFIQTSHKEKVQEFNEKLGRLPEHHEMPKVGPG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.47
3 0.55
4 0.63
5 0.67
6 0.74
7 0.79
8 0.85
9 0.88
10 0.9
11 0.92
12 0.93
13 0.94
14 0.92
15 0.92
16 0.89
17 0.86
18 0.8
19 0.72
20 0.65
21 0.55
22 0.45
23 0.34
24 0.26
25 0.18
26 0.14
27 0.11
28 0.08
29 0.07
30 0.08
31 0.08
32 0.08
33 0.08
34 0.09
35 0.08
36 0.08
37 0.11
38 0.11
39 0.11
40 0.12
41 0.12
42 0.12
43 0.12
44 0.12
45 0.1
46 0.1
47 0.09
48 0.08
49 0.07
50 0.07
51 0.08
52 0.07
53 0.06
54 0.06
55 0.07
56 0.12
57 0.14
58 0.21
59 0.25
60 0.3
61 0.33
62 0.4
63 0.5
64 0.56
65 0.64
66 0.68
67 0.73
68 0.74
69 0.82
70 0.86
71 0.82
72 0.81
73 0.79
74 0.74
75 0.65
76 0.6
77 0.51
78 0.46
79 0.46
80 0.4
81 0.34
82 0.31
83 0.33
84 0.34
85 0.4
86 0.42
87 0.46
88 0.43
89 0.49
90 0.51
91 0.49
92 0.48
93 0.45
94 0.41
95 0.33
96 0.37
97 0.35
98 0.38
99 0.41
100 0.42
101 0.39