Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T9YAD6

Protein Details
Accession A0A2T9YAD6   
Localization Confidence Low
Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
10-31QENTTNKPKKKFDKTMIGNPTNHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 17.5, cyto_nucl 13.833, cyto 7, cyto_mito 4.999
Family & Domain DBs
InterPro View protein in InterPro  
IPR000095  CRIB_dom  
IPR036936  CRIB_dom_sf  
Pfam View protein in Pfam  
PF00786  PBD  
PROSITE View protein in PROSITE  
PS50108  CRIB  
Amino Acid Sequences MSIFLSCFGQENTTNKPKKKFDKTMIGNPTNFTHNVHLGVNSISDDTLTSENVNLLKCDVLPRNNSYYDSAQTHHKNSNSYSQNSPKHTDVINRPVMAT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.48
3 0.56
4 0.62
5 0.68
6 0.75
7 0.77
8 0.75
9 0.79
10 0.81
11 0.82
12 0.82
13 0.76
14 0.66
15 0.58
16 0.51
17 0.43
18 0.36
19 0.28
20 0.22
21 0.18
22 0.19
23 0.18
24 0.16
25 0.14
26 0.14
27 0.12
28 0.09
29 0.08
30 0.06
31 0.05
32 0.05
33 0.06
34 0.06
35 0.06
36 0.06
37 0.06
38 0.07
39 0.09
40 0.09
41 0.07
42 0.07
43 0.07
44 0.07
45 0.11
46 0.13
47 0.16
48 0.19
49 0.23
50 0.26
51 0.27
52 0.29
53 0.29
54 0.28
55 0.28
56 0.26
57 0.24
58 0.29
59 0.31
60 0.34
61 0.36
62 0.36
63 0.35
64 0.36
65 0.45
66 0.43
67 0.43
68 0.46
69 0.5
70 0.55
71 0.57
72 0.59
73 0.51
74 0.49
75 0.48
76 0.49
77 0.48
78 0.5
79 0.52