Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E2LH93

Protein Details
Accession E2LH93    Localization Confidence Low Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
6-29NSFQDSPKSRLRRRSRKAIQYDGIHydrophilic
NLS Segment(s)
PositionSequence
15-21RLRRRSR
Subcellular Location(s) plas 10, mito 9, nucl 3, cyto 2, E.R. 2
Family & Domain DBs
KEGG mpr:MPER_05859  -  
Amino Acid Sequences TVTKPNSFQDSPKSRLRRRSRKAIQYDGILPLAPSKSSTEIVVFTNVKTVFTRSSNGNVKVLYETQGEKPLGTVVATGGKVVCTGFHETCMKGSVRDDVDITFVDLQGGSIFPGLVSFGAPLGLEHINQEPSTNDGDLRVLWMVYCSTPAMLCLHIVLV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.62
2 0.71
3 0.78
4 0.78
5 0.8
6 0.86
7 0.86
8 0.87
9 0.88
10 0.87
11 0.8
12 0.73
13 0.67
14 0.58
15 0.48
16 0.38
17 0.29
18 0.22
19 0.19
20 0.14
21 0.13
22 0.12
23 0.14
24 0.15
25 0.16
26 0.15
27 0.15
28 0.16
29 0.2
30 0.18
31 0.15
32 0.2
33 0.19
34 0.19
35 0.18
36 0.19
37 0.17
38 0.18
39 0.21
40 0.17
41 0.25
42 0.3
43 0.31
44 0.31
45 0.28
46 0.27
47 0.27
48 0.25
49 0.2
50 0.15
51 0.15
52 0.14
53 0.19
54 0.19
55 0.16
56 0.16
57 0.14
58 0.13
59 0.11
60 0.09
61 0.05
62 0.07
63 0.07
64 0.07
65 0.06
66 0.06
67 0.06
68 0.06
69 0.06
70 0.06
71 0.1
72 0.1
73 0.13
74 0.14
75 0.14
76 0.15
77 0.17
78 0.15
79 0.12
80 0.13
81 0.15
82 0.14
83 0.15
84 0.15
85 0.13
86 0.14
87 0.13
88 0.14
89 0.09
90 0.08
91 0.07
92 0.07
93 0.07
94 0.05
95 0.05
96 0.04
97 0.04
98 0.04
99 0.04
100 0.04
101 0.04
102 0.04
103 0.04
104 0.04
105 0.04
106 0.04
107 0.04
108 0.04
109 0.07
110 0.08
111 0.08
112 0.09
113 0.11
114 0.13
115 0.13
116 0.14
117 0.12
118 0.13
119 0.16
120 0.15
121 0.13
122 0.12
123 0.13
124 0.12
125 0.14
126 0.12
127 0.09
128 0.09
129 0.1
130 0.1
131 0.1
132 0.11
133 0.09
134 0.09
135 0.1
136 0.11
137 0.12
138 0.11
139 0.11