Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T9YMZ6

Protein Details
Accession A0A2T9YMZ6    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
69-93GQFRCAPKSRAKWKKVKACINRSVSHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 20, golg 3, mito 1, cyto 1, pero 1, E.R. 1, cyto_mito 1, cyto_pero 1
Family & Domain DBs
Amino Acid Sequences MRVLTFSAVLVLITLLQGVTSDYTSQPNHNKDKNQSTTQAKRMCAKVYGNGRYNFFLQSGDKCNCRDDGQFRCAPKSRAKWKKVKACINRSVSMGFFNGFRGARCICDDEDGSMICFNRKITPVN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.04
3 0.03
4 0.04
5 0.04
6 0.05
7 0.06
8 0.07
9 0.09
10 0.13
11 0.15
12 0.21
13 0.28
14 0.34
15 0.42
16 0.46
17 0.52
18 0.56
19 0.64
20 0.65
21 0.62
22 0.62
23 0.62
24 0.64
25 0.66
26 0.63
27 0.56
28 0.54
29 0.53
30 0.47
31 0.42
32 0.36
33 0.35
34 0.38
35 0.42
36 0.43
37 0.42
38 0.41
39 0.39
40 0.39
41 0.32
42 0.24
43 0.19
44 0.14
45 0.15
46 0.19
47 0.19
48 0.2
49 0.2
50 0.21
51 0.21
52 0.21
53 0.22
54 0.22
55 0.26
56 0.3
57 0.33
58 0.33
59 0.36
60 0.38
61 0.38
62 0.4
63 0.44
64 0.49
65 0.56
66 0.63
67 0.68
68 0.74
69 0.81
70 0.83
71 0.83
72 0.83
73 0.82
74 0.83
75 0.79
76 0.71
77 0.63
78 0.55
79 0.45
80 0.36
81 0.28
82 0.19
83 0.14
84 0.13
85 0.15
86 0.14
87 0.14
88 0.16
89 0.16
90 0.17
91 0.2
92 0.22
93 0.19
94 0.23
95 0.23
96 0.21
97 0.22
98 0.21
99 0.19
100 0.18
101 0.18
102 0.15
103 0.16
104 0.16
105 0.19