Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T9YEB2

Protein Details
Accession A0A2T9YEB2    Localization Confidence Medium Confidence Score 12.1
NoLS Segment(s)
PositionSequenceProtein Nature
155-178RELLVKRTIQKKKKTKASLYAKIDHydrophilic
NLS Segment(s)
PositionSequence
165-168KKKK
Subcellular Location(s) nucl 14, cyto_nucl 10, mito 6, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR029012  Helix_hairpin_bin_sf  
IPR009360  Isy1  
IPR037200  Isy1_sf  
Gene Ontology GO:0016020  C:membrane  
GO:0005634  C:nucleus  
GO:0000350  P:generation of catalytic spliceosome for second transesterification step  
Pfam View protein in Pfam  
PF06246  Isy1  
Amino Acid Sequences MARNQEKAQTMLYRFREIQAIELGLVKPEEKRPFLASRVNSLPQAEKWRRHVIRDISKAVSKIHDGSLPENQIRDLNDQINKLLREKSHWETRIKEIGGPDYMVSTSPIYSFSYFCFILQSCLSLFLLFILAENRPENAGRRWYFGRARDLPGVRELLVKRTIQKKKKTKASLYAKIDASYYGYNDEDSEGELIQYEKIVSEKLLYNLEQKNQLYSVDSDQSISDDTSVSSSSDLSDS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.43
3 0.43
4 0.36
5 0.35
6 0.29
7 0.26
8 0.21
9 0.22
10 0.21
11 0.17
12 0.17
13 0.15
14 0.14
15 0.21
16 0.27
17 0.26
18 0.29
19 0.33
20 0.37
21 0.41
22 0.46
23 0.41
24 0.42
25 0.45
26 0.44
27 0.4
28 0.38
29 0.37
30 0.33
31 0.41
32 0.41
33 0.42
34 0.46
35 0.56
36 0.56
37 0.57
38 0.62
39 0.61
40 0.64
41 0.65
42 0.63
43 0.56
44 0.56
45 0.53
46 0.46
47 0.38
48 0.3
49 0.25
50 0.22
51 0.21
52 0.2
53 0.21
54 0.25
55 0.27
56 0.25
57 0.23
58 0.22
59 0.21
60 0.22
61 0.22
62 0.19
63 0.2
64 0.23
65 0.23
66 0.24
67 0.26
68 0.25
69 0.24
70 0.25
71 0.21
72 0.23
73 0.28
74 0.33
75 0.37
76 0.41
77 0.43
78 0.43
79 0.48
80 0.49
81 0.44
82 0.4
83 0.32
84 0.29
85 0.26
86 0.23
87 0.17
88 0.11
89 0.11
90 0.09
91 0.09
92 0.07
93 0.06
94 0.06
95 0.08
96 0.08
97 0.09
98 0.09
99 0.09
100 0.12
101 0.12
102 0.12
103 0.12
104 0.1
105 0.12
106 0.11
107 0.11
108 0.08
109 0.09
110 0.09
111 0.08
112 0.07
113 0.05
114 0.06
115 0.05
116 0.05
117 0.05
118 0.05
119 0.06
120 0.07
121 0.07
122 0.07
123 0.08
124 0.11
125 0.13
126 0.21
127 0.2
128 0.24
129 0.25
130 0.3
131 0.34
132 0.36
133 0.41
134 0.37
135 0.4
136 0.42
137 0.42
138 0.38
139 0.35
140 0.32
141 0.24
142 0.26
143 0.23
144 0.2
145 0.22
146 0.22
147 0.26
148 0.35
149 0.44
150 0.47
151 0.58
152 0.64
153 0.7
154 0.79
155 0.83
156 0.81
157 0.82
158 0.83
159 0.83
160 0.79
161 0.75
162 0.66
163 0.57
164 0.5
165 0.39
166 0.32
167 0.23
168 0.17
169 0.13
170 0.13
171 0.12
172 0.12
173 0.13
174 0.1
175 0.1
176 0.1
177 0.08
178 0.08
179 0.08
180 0.08
181 0.07
182 0.07
183 0.06
184 0.06
185 0.07
186 0.08
187 0.07
188 0.1
189 0.13
190 0.15
191 0.18
192 0.19
193 0.26
194 0.29
195 0.33
196 0.37
197 0.34
198 0.35
199 0.33
200 0.32
201 0.28
202 0.26
203 0.28
204 0.24
205 0.24
206 0.22
207 0.21
208 0.22
209 0.2
210 0.18
211 0.14
212 0.1
213 0.1
214 0.11
215 0.12
216 0.11
217 0.1
218 0.09