Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T9YC24

Protein Details
Accession A0A2T9YC24    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
63-82SERRRWPGRDFWRRRCSRRDBasic
NLS Segment(s)
PositionSequence
55-69RGRRPSNDSERRRWP
Subcellular Location(s) extr 18, plas 4, E.R. 2, golg 2
Family & Domain DBs
Amino Acid Sequences MLSTKQVLGFLVIVQALLQVSVLESQGAEDNNSSSAIVQTVDPGRSLRPTDDSRRGRRPSNDSERRRWPGRDFWRRRCSRRDSFCDIDSWRGYYECSRNRYIYKVCDRGSYCTSSRFGIRCRRF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.08
3 0.06
4 0.05
5 0.05
6 0.04
7 0.04
8 0.05
9 0.05
10 0.05
11 0.05
12 0.06
13 0.08
14 0.09
15 0.09
16 0.08
17 0.09
18 0.1
19 0.1
20 0.09
21 0.07
22 0.07
23 0.07
24 0.07
25 0.06
26 0.08
27 0.1
28 0.11
29 0.11
30 0.11
31 0.12
32 0.14
33 0.15
34 0.14
35 0.17
36 0.22
37 0.28
38 0.38
39 0.45
40 0.49
41 0.57
42 0.59
43 0.59
44 0.6
45 0.6
46 0.6
47 0.63
48 0.67
49 0.63
50 0.66
51 0.69
52 0.69
53 0.66
54 0.6
55 0.53
56 0.53
57 0.58
58 0.63
59 0.63
60 0.68
61 0.75
62 0.79
63 0.8
64 0.79
65 0.77
66 0.76
67 0.76
68 0.74
69 0.71
70 0.68
71 0.64
72 0.6
73 0.52
74 0.47
75 0.38
76 0.32
77 0.25
78 0.2
79 0.21
80 0.22
81 0.29
82 0.31
83 0.35
84 0.38
85 0.41
86 0.43
87 0.48
88 0.48
89 0.49
90 0.52
91 0.55
92 0.52
93 0.56
94 0.56
95 0.56
96 0.54
97 0.51
98 0.43
99 0.4
100 0.4
101 0.35
102 0.39
103 0.37
104 0.41