Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2V1E555

Protein Details
Accession A0A2V1E555    Localization Confidence Medium Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
11-37RSASGAKRAYYRKKRAFEKGRQPANTRHydrophilic
NLS Segment(s)
PositionSequence
8-56RHKRSASGAKRAYYRKKRAFEKGRQPANTRIGAKRIHLVRTRGGNRKFR
124-139KRQTKAGEKEEDKKKS
Subcellular Location(s) nucl 11, mito 11, mito_nucl 11
Family & Domain DBs
InterPro View protein in InterPro  
IPR001047  Ribosomal_S8e  
IPR022309  Ribosomal_S8e/biogenesis_NSA2  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01201  Ribosomal_S8e  
CDD cd11380  Ribosomal_S8e_like  
Amino Acid Sequences MGISRDSRHKRSASGAKRAYYRKKRAFEKGRQPANTRIGAKRIHLVRTRGGNRKFRALRLDSGNFSWGSEGIAKKTRVIGVVYHPSNNELVRTNTLTKSAVVQIDAAPFRQWYEAHYGTTLGRKRQTKAGEKEEDKKKSNSVQKKQAERVKTSGKVENAVEKQFEAGRLYAVVSSRPGQSGRLDGYVLEGEELAFYQRALRK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.65
2 0.65
3 0.63
4 0.68
5 0.74
6 0.75
7 0.75
8 0.77
9 0.76
10 0.79
11 0.83
12 0.86
13 0.87
14 0.86
15 0.87
16 0.86
17 0.86
18 0.83
19 0.79
20 0.77
21 0.73
22 0.69
23 0.62
24 0.55
25 0.51
26 0.48
27 0.45
28 0.43
29 0.41
30 0.41
31 0.43
32 0.43
33 0.43
34 0.5
35 0.56
36 0.58
37 0.62
38 0.63
39 0.6
40 0.67
41 0.64
42 0.58
43 0.59
44 0.53
45 0.51
46 0.49
47 0.51
48 0.42
49 0.4
50 0.38
51 0.3
52 0.26
53 0.21
54 0.13
55 0.11
56 0.12
57 0.12
58 0.13
59 0.19
60 0.19
61 0.19
62 0.21
63 0.21
64 0.19
65 0.19
66 0.18
67 0.18
68 0.25
69 0.25
70 0.24
71 0.23
72 0.23
73 0.23
74 0.21
75 0.17
76 0.11
77 0.12
78 0.14
79 0.16
80 0.17
81 0.16
82 0.17
83 0.17
84 0.15
85 0.15
86 0.15
87 0.12
88 0.11
89 0.11
90 0.1
91 0.12
92 0.12
93 0.11
94 0.09
95 0.09
96 0.09
97 0.1
98 0.09
99 0.08
100 0.15
101 0.16
102 0.16
103 0.17
104 0.17
105 0.17
106 0.23
107 0.24
108 0.2
109 0.26
110 0.28
111 0.3
112 0.36
113 0.43
114 0.47
115 0.52
116 0.57
117 0.6
118 0.6
119 0.68
120 0.7
121 0.69
122 0.63
123 0.57
124 0.52
125 0.52
126 0.58
127 0.59
128 0.59
129 0.63
130 0.67
131 0.74
132 0.78
133 0.77
134 0.73
135 0.67
136 0.65
137 0.62
138 0.59
139 0.55
140 0.53
141 0.47
142 0.45
143 0.42
144 0.43
145 0.39
146 0.35
147 0.32
148 0.26
149 0.26
150 0.24
151 0.24
152 0.17
153 0.14
154 0.13
155 0.13
156 0.13
157 0.13
158 0.12
159 0.12
160 0.13
161 0.14
162 0.15
163 0.17
164 0.17
165 0.18
166 0.2
167 0.23
168 0.24
169 0.23
170 0.22
171 0.2
172 0.22
173 0.21
174 0.19
175 0.14
176 0.11
177 0.09
178 0.09
179 0.1
180 0.08
181 0.07
182 0.07