Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2V1DBY8

Protein Details
Accession A0A2V1DBY8   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
51-78LTTFQPPRPRPRPPSREKIKDKRYDGDNHydrophilic
NLS Segment(s)
PositionSequence
58-72RPRPRPPSREKIKDK
Subcellular Location(s) extr 8, E.R. 5, mito 4, plas 4, golg 4
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MCTYISPFLYLTFIPFLFLTSVIPFHISFHLPLPHDSHSQLTHLSLLPSYLTTFQPPRPRPRPPSREKIKDKRYDGDNDTN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.13
3 0.13
4 0.12
5 0.12
6 0.11
7 0.09
8 0.1
9 0.09
10 0.11
11 0.09
12 0.1
13 0.12
14 0.12
15 0.12
16 0.14
17 0.17
18 0.17
19 0.18
20 0.2
21 0.2
22 0.21
23 0.21
24 0.2
25 0.17
26 0.17
27 0.16
28 0.13
29 0.11
30 0.1
31 0.1
32 0.08
33 0.07
34 0.07
35 0.07
36 0.07
37 0.08
38 0.08
39 0.11
40 0.14
41 0.19
42 0.29
43 0.34
44 0.44
45 0.49
46 0.58
47 0.64
48 0.73
49 0.78
50 0.77
51 0.83
52 0.83
53 0.87
54 0.89
55 0.9
56 0.89
57 0.88
58 0.85
59 0.82
60 0.78
61 0.75