Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2V1EES7

Protein Details
Accession A0A2V1EES7    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
6-39GSLPRALPAKKQPPKPQLAKKPPPQKQAPQQQSWHydrophilic
NLS Segment(s)
PositionSequence
13-28PAKKQPPKPQLAKKPP
Subcellular Location(s) nucl 13.5, mito 9, cyto_nucl 8, extr 3
Family & Domain DBs
Amino Acid Sequences MQAANGSLPRALPAKKQPPKPQLAKKPPPQKQAPQQQSWFTRTTNAAASGIGNFGNAVVSAVGNGVSGAGKGAGASITNSSRTWGETVREYGNSIKDATGAGGPRGVSSTNPLGLASTASGAKAIMSSKPGPTPRKGTANNPLGL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.5
3 0.6
4 0.68
5 0.73
6 0.81
7 0.84
8 0.85
9 0.85
10 0.88
11 0.88
12 0.88
13 0.89
14 0.88
15 0.87
16 0.84
17 0.82
18 0.81
19 0.82
20 0.8
21 0.76
22 0.73
23 0.71
24 0.68
25 0.62
26 0.55
27 0.44
28 0.39
29 0.33
30 0.31
31 0.25
32 0.22
33 0.18
34 0.16
35 0.16
36 0.13
37 0.12
38 0.09
39 0.07
40 0.05
41 0.05
42 0.04
43 0.04
44 0.04
45 0.03
46 0.03
47 0.03
48 0.03
49 0.03
50 0.03
51 0.03
52 0.03
53 0.03
54 0.03
55 0.03
56 0.03
57 0.03
58 0.02
59 0.03
60 0.03
61 0.03
62 0.03
63 0.05
64 0.06
65 0.07
66 0.08
67 0.09
68 0.09
69 0.1
70 0.11
71 0.11
72 0.12
73 0.13
74 0.16
75 0.17
76 0.17
77 0.18
78 0.18
79 0.18
80 0.18
81 0.16
82 0.13
83 0.12
84 0.12
85 0.11
86 0.11
87 0.1
88 0.09
89 0.1
90 0.1
91 0.1
92 0.11
93 0.1
94 0.08
95 0.12
96 0.14
97 0.14
98 0.14
99 0.14
100 0.14
101 0.13
102 0.14
103 0.1
104 0.08
105 0.07
106 0.07
107 0.07
108 0.07
109 0.07
110 0.07
111 0.08
112 0.08
113 0.13
114 0.15
115 0.18
116 0.25
117 0.33
118 0.37
119 0.42
120 0.48
121 0.51
122 0.59
123 0.6
124 0.62
125 0.64