Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2V1CXS6

Protein Details
Accession A0A2V1CXS6    Localization Confidence Medium Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
44-73TIPRLERRVEPPRKRRKTKPNRISRACLSCHydrophilic
NLS Segment(s)
PositionSequence
50-65RRVEPPRKRRKTKPNR
Subcellular Location(s) nucl 22, cyto_nucl 14.5, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR036864  Zn2-C6_fun-type_DNA-bd_sf  
IPR001138  Zn2Cys6_DnaBD  
Gene Ontology GO:0005634  C:nucleus  
GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF00172  Zn_clus  
PROSITE View protein in PROSITE  
PS00463  ZN2_CY6_FUNGAL_1  
PS50048  ZN2_CY6_FUNGAL_2  
CDD cd00067  GAL4  
Amino Acid Sequences MRPKSGSFHSHKLNVNDKSLDSLLEIWNFTHVLPLSRSLLTLCTIPRLERRVEPPRKRRKTKPNRISRACLSCRARKIRCNGAQPTCNNCTDSESPCVYAS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.6
2 0.57
3 0.52
4 0.45
5 0.42
6 0.36
7 0.3
8 0.21
9 0.19
10 0.17
11 0.16
12 0.16
13 0.12
14 0.13
15 0.13
16 0.11
17 0.13
18 0.11
19 0.12
20 0.12
21 0.15
22 0.16
23 0.15
24 0.16
25 0.13
26 0.13
27 0.12
28 0.13
29 0.1
30 0.11
31 0.12
32 0.13
33 0.16
34 0.18
35 0.19
36 0.2
37 0.28
38 0.35
39 0.45
40 0.53
41 0.6
42 0.69
43 0.77
44 0.82
45 0.85
46 0.86
47 0.87
48 0.89
49 0.89
50 0.89
51 0.9
52 0.88
53 0.85
54 0.8
55 0.78
56 0.7
57 0.68
58 0.63
59 0.6
60 0.62
61 0.65
62 0.63
63 0.61
64 0.65
65 0.67
66 0.69
67 0.7
68 0.7
69 0.68
70 0.7
71 0.68
72 0.68
73 0.62
74 0.56
75 0.49
76 0.41
77 0.39
78 0.36
79 0.35
80 0.34
81 0.32