Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2V1DX45

Protein Details
Accession A0A2V1DX45    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
61-81CYTPRFPLRHVLRRRSQRPAAHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 10, cyto 7, extr 6, plas 2
Family & Domain DBs
Amino Acid Sequences MWLRVCLSVFVTRDVARPGDDGLLACLLACCVPCHLRYCYGYWPPRPCTSKHLHGDPYHLCYTPRFPLRHVLRRRSQRPAATYMV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.24
3 0.19
4 0.19
5 0.17
6 0.15
7 0.14
8 0.12
9 0.11
10 0.1
11 0.09
12 0.08
13 0.06
14 0.05
15 0.05
16 0.06
17 0.05
18 0.07
19 0.09
20 0.1
21 0.14
22 0.15
23 0.19
24 0.2
25 0.22
26 0.26
27 0.32
28 0.36
29 0.38
30 0.42
31 0.42
32 0.47
33 0.47
34 0.43
35 0.43
36 0.44
37 0.48
38 0.47
39 0.49
40 0.48
41 0.47
42 0.51
43 0.46
44 0.46
45 0.38
46 0.34
47 0.29
48 0.25
49 0.28
50 0.3
51 0.35
52 0.3
53 0.3
54 0.4
55 0.49
56 0.57
57 0.62
58 0.64
59 0.66
60 0.76
61 0.81
62 0.8
63 0.79
64 0.78
65 0.73