Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2V1E4K0

Protein Details
Accession A0A2V1E4K0    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
74-93APFRSGRRDLPRRRLRRDVDBasic
NLS Segment(s)
Subcellular Location(s) extr 26
Family & Domain DBs
Amino Acid Sequences MKLSVALSLAFAALAFSAPHDINEENDALEARQIRVPNIPNPSQLIPGRQPANQPAQQPQQQAGSNVPPRDLSAPFRSGRRDLPRRRLRRDVDDINEGDDALEARQIPGLPKQISGLPKQIPNPAKIIPGL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.04
3 0.05
4 0.08
5 0.08
6 0.09
7 0.11
8 0.12
9 0.13
10 0.15
11 0.15
12 0.12
13 0.12
14 0.12
15 0.09
16 0.11
17 0.11
18 0.11
19 0.13
20 0.14
21 0.15
22 0.2
23 0.23
24 0.26
25 0.31
26 0.31
27 0.3
28 0.32
29 0.32
30 0.32
31 0.3
32 0.29
33 0.25
34 0.29
35 0.29
36 0.27
37 0.28
38 0.27
39 0.33
40 0.32
41 0.31
42 0.31
43 0.35
44 0.38
45 0.37
46 0.34
47 0.31
48 0.28
49 0.28
50 0.24
51 0.24
52 0.24
53 0.23
54 0.22
55 0.18
56 0.18
57 0.19
58 0.19
59 0.18
60 0.18
61 0.22
62 0.22
63 0.25
64 0.27
65 0.27
66 0.32
67 0.38
68 0.45
69 0.49
70 0.59
71 0.67
72 0.73
73 0.78
74 0.8
75 0.76
76 0.75
77 0.75
78 0.72
79 0.66
80 0.63
81 0.56
82 0.48
83 0.42
84 0.33
85 0.24
86 0.17
87 0.13
88 0.07
89 0.08
90 0.06
91 0.06
92 0.08
93 0.09
94 0.1
95 0.15
96 0.22
97 0.21
98 0.22
99 0.23
100 0.27
101 0.3
102 0.33
103 0.35
104 0.32
105 0.36
106 0.39
107 0.46
108 0.46
109 0.44
110 0.45
111 0.4