Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2V1DRS2

Protein Details
Accession A0A2V1DRS2   
Localization Confidence Medium
Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
430-456AYCFVLSCRRRVREKKMEKEMERGRREHydrophilic
NLS Segment(s)
PositionSequence
440-448RVREKKMEK
478-478K
Subcellular Location(s) extr 13, cyto 5, mito 2, plas 2, E.R. 2, nucl 1, pero 1, golg 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR033121  PEPTIDASE_A1  
IPR021109  Peptidase_aspartic_dom_sf  
Gene Ontology GO:0016020  C:membrane  
Pfam View protein in Pfam  
PF00026  Asp  
PROSITE View protein in PROSITE  
PS51767  PEPTIDASE_A1  
Amino Acid Sequences MASLVFYLGASVLFAQSTLAFNCSKPPVYVDIHKRAVHDSPVFQYGSFIGVGSPPQNHSLWPSLSLNHTSFAARSYCSNSTLRDCETSTGGFFQPRDSTSFSEQKDFQTLDSSSNLTKGFFGKDIIRLYTHYFETDGASQTLLENSTVKVSESGSAIGSMVGMGDSSTVLRDLASRDMIAGRTYSLYIGQGFDRAGGAVNGSNTFGGYDSGRFTGPVSKYSMDSSKMNPMSLLVKDIVLTESANPKSNVSLFDPSAFPSMKSRPEKFLAEITTDQYPLSLPYQITQNFISRLGAVKDNTWNDNSLKLKNPFNGTLSIILDDDFTVTLPAEILSNQSNITPIQDRDEKSTAPFYLSVAFLTQVYLMADYDSQNFFLARAVQKNNAVMPVPFCPKSTPVAYEPPKQNAWLKQGLIGAVIGGVLGGIGVAFAAYCFVLSCRRRVREKKMEKEMERGRREVKMAQMEVEDVPEFDPPPKSKKMAAKGIFGWRK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.06
3 0.07
4 0.1
5 0.1
6 0.12
7 0.13
8 0.13
9 0.2
10 0.24
11 0.24
12 0.23
13 0.26
14 0.29
15 0.34
16 0.43
17 0.46
18 0.51
19 0.56
20 0.57
21 0.55
22 0.53
23 0.51
24 0.5
25 0.44
26 0.39
27 0.36
28 0.38
29 0.37
30 0.33
31 0.3
32 0.23
33 0.2
34 0.16
35 0.13
36 0.08
37 0.09
38 0.11
39 0.12
40 0.14
41 0.14
42 0.18
43 0.18
44 0.18
45 0.22
46 0.26
47 0.24
48 0.27
49 0.27
50 0.25
51 0.29
52 0.33
53 0.29
54 0.25
55 0.25
56 0.21
57 0.2
58 0.2
59 0.19
60 0.15
61 0.16
62 0.21
63 0.22
64 0.25
65 0.27
66 0.28
67 0.32
68 0.35
69 0.35
70 0.32
71 0.31
72 0.29
73 0.3
74 0.27
75 0.22
76 0.21
77 0.2
78 0.2
79 0.19
80 0.2
81 0.21
82 0.21
83 0.23
84 0.24
85 0.26
86 0.3
87 0.37
88 0.36
89 0.38
90 0.38
91 0.37
92 0.39
93 0.35
94 0.29
95 0.27
96 0.26
97 0.23
98 0.23
99 0.23
100 0.18
101 0.2
102 0.2
103 0.15
104 0.16
105 0.15
106 0.16
107 0.15
108 0.17
109 0.17
110 0.21
111 0.23
112 0.23
113 0.23
114 0.22
115 0.25
116 0.26
117 0.24
118 0.2
119 0.18
120 0.17
121 0.18
122 0.19
123 0.17
124 0.14
125 0.13
126 0.12
127 0.12
128 0.12
129 0.1
130 0.09
131 0.08
132 0.08
133 0.09
134 0.09
135 0.09
136 0.09
137 0.09
138 0.11
139 0.11
140 0.11
141 0.1
142 0.1
143 0.09
144 0.08
145 0.07
146 0.05
147 0.04
148 0.03
149 0.03
150 0.03
151 0.03
152 0.03
153 0.03
154 0.04
155 0.04
156 0.04
157 0.04
158 0.05
159 0.07
160 0.09
161 0.1
162 0.09
163 0.1
164 0.11
165 0.12
166 0.11
167 0.1
168 0.08
169 0.08
170 0.08
171 0.08
172 0.07
173 0.07
174 0.07
175 0.08
176 0.08
177 0.08
178 0.08
179 0.08
180 0.07
181 0.07
182 0.07
183 0.05
184 0.06
185 0.05
186 0.06
187 0.06
188 0.06
189 0.06
190 0.06
191 0.06
192 0.06
193 0.06
194 0.06
195 0.06
196 0.07
197 0.08
198 0.08
199 0.08
200 0.09
201 0.14
202 0.15
203 0.16
204 0.18
205 0.18
206 0.19
207 0.21
208 0.22
209 0.18
210 0.19
211 0.19
212 0.24
213 0.24
214 0.23
215 0.21
216 0.2
217 0.19
218 0.18
219 0.18
220 0.1
221 0.09
222 0.09
223 0.1
224 0.09
225 0.07
226 0.07
227 0.06
228 0.12
229 0.13
230 0.15
231 0.15
232 0.15
233 0.15
234 0.16
235 0.17
236 0.15
237 0.16
238 0.14
239 0.16
240 0.16
241 0.16
242 0.17
243 0.15
244 0.13
245 0.14
246 0.17
247 0.23
248 0.29
249 0.3
250 0.32
251 0.35
252 0.37
253 0.35
254 0.36
255 0.29
256 0.26
257 0.25
258 0.23
259 0.2
260 0.19
261 0.16
262 0.12
263 0.11
264 0.09
265 0.09
266 0.09
267 0.08
268 0.09
269 0.15
270 0.15
271 0.18
272 0.18
273 0.19
274 0.18
275 0.18
276 0.17
277 0.13
278 0.14
279 0.13
280 0.15
281 0.13
282 0.14
283 0.19
284 0.21
285 0.22
286 0.21
287 0.22
288 0.19
289 0.25
290 0.25
291 0.23
292 0.28
293 0.3
294 0.33
295 0.35
296 0.38
297 0.34
298 0.34
299 0.33
300 0.27
301 0.25
302 0.22
303 0.19
304 0.15
305 0.13
306 0.11
307 0.09
308 0.08
309 0.06
310 0.05
311 0.05
312 0.05
313 0.04
314 0.04
315 0.05
316 0.04
317 0.04
318 0.06
319 0.07
320 0.08
321 0.08
322 0.08
323 0.09
324 0.09
325 0.12
326 0.13
327 0.13
328 0.18
329 0.23
330 0.24
331 0.3
332 0.32
333 0.3
334 0.29
335 0.32
336 0.27
337 0.24
338 0.23
339 0.17
340 0.17
341 0.16
342 0.14
343 0.11
344 0.11
345 0.09
346 0.09
347 0.08
348 0.07
349 0.07
350 0.07
351 0.06
352 0.06
353 0.07
354 0.08
355 0.1
356 0.1
357 0.11
358 0.11
359 0.11
360 0.1
361 0.11
362 0.15
363 0.16
364 0.22
365 0.24
366 0.27
367 0.3
368 0.32
369 0.31
370 0.29
371 0.26
372 0.21
373 0.2
374 0.22
375 0.24
376 0.24
377 0.23
378 0.24
379 0.25
380 0.29
381 0.29
382 0.29
383 0.28
384 0.37
385 0.41
386 0.47
387 0.51
388 0.51
389 0.5
390 0.49
391 0.51
392 0.47
393 0.49
394 0.46
395 0.41
396 0.39
397 0.4
398 0.36
399 0.3
400 0.24
401 0.17
402 0.1
403 0.1
404 0.05
405 0.03
406 0.03
407 0.02
408 0.02
409 0.02
410 0.01
411 0.01
412 0.01
413 0.02
414 0.02
415 0.02
416 0.03
417 0.03
418 0.03
419 0.04
420 0.05
421 0.15
422 0.17
423 0.26
424 0.35
425 0.42
426 0.53
427 0.62
428 0.72
429 0.74
430 0.84
431 0.85
432 0.87
433 0.91
434 0.84
435 0.85
436 0.84
437 0.83
438 0.77
439 0.72
440 0.65
441 0.6
442 0.6
443 0.54
444 0.53
445 0.51
446 0.47
447 0.44
448 0.41
449 0.38
450 0.35
451 0.32
452 0.24
453 0.15
454 0.14
455 0.14
456 0.14
457 0.15
458 0.22
459 0.23
460 0.29
461 0.35
462 0.38
463 0.44
464 0.53
465 0.6
466 0.63
467 0.64
468 0.65
469 0.65