Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2V1D9A0

Protein Details
Accession A0A2V1D9A0    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MSKSCKIIRFKKKPPSSLVVHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 23.5, mito_nucl 13.666, cyto_nucl 2.833
Family & Domain DBs
Amino Acid Sequences MSKSCKIIRFKKKPPSSLVVSYIHTYIRVCVPCTCICHPRFPSSIPAPCNSKSQQNKGTNPTTRTNRGSVSHLSHITFLTPQKGSKGEGGREGPPHLTSPHLTSAKISC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.79
3 0.74
4 0.69
5 0.64
6 0.56
7 0.49
8 0.43
9 0.37
10 0.3
11 0.24
12 0.18
13 0.15
14 0.18
15 0.18
16 0.18
17 0.19
18 0.23
19 0.25
20 0.3
21 0.32
22 0.34
23 0.34
24 0.41
25 0.42
26 0.43
27 0.42
28 0.38
29 0.42
30 0.4
31 0.43
32 0.37
33 0.36
34 0.35
35 0.34
36 0.37
37 0.32
38 0.35
39 0.35
40 0.4
41 0.46
42 0.49
43 0.52
44 0.53
45 0.59
46 0.55
47 0.54
48 0.55
49 0.51
50 0.49
51 0.48
52 0.44
53 0.4
54 0.37
55 0.37
56 0.33
57 0.32
58 0.31
59 0.3
60 0.28
61 0.26
62 0.24
63 0.21
64 0.2
65 0.16
66 0.17
67 0.16
68 0.16
69 0.18
70 0.2
71 0.21
72 0.25
73 0.3
74 0.28
75 0.34
76 0.36
77 0.37
78 0.38
79 0.38
80 0.33
81 0.29
82 0.29
83 0.23
84 0.24
85 0.22
86 0.24
87 0.3
88 0.3
89 0.29