Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2V1E0S6

Protein Details
Accession A0A2V1E0S6    Localization Confidence Low Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
45-70PATRKAMSRATRKRRSEKSRKVTSGSHydrophilic
NLS Segment(s)
PositionSequence
36-65RSAKPNSSRPATRKAMSRATRKRRSEKSRK
Subcellular Location(s) mito 22, nucl 4.5, cyto_nucl 3
Family & Domain DBs
Amino Acid Sequences MKRSIPAALTSPTQAPLHLCRSHRPVHAANSRSVSRSAKPNSSRPATRKAMSRATRKRRSEKSRKVTSGSRGCSKVSMRVVATAMATRLKVGAL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.2
3 0.22
4 0.27
5 0.3
6 0.31
7 0.34
8 0.4
9 0.45
10 0.45
11 0.46
12 0.44
13 0.47
14 0.54
15 0.5
16 0.47
17 0.46
18 0.44
19 0.39
20 0.38
21 0.31
22 0.26
23 0.32
24 0.33
25 0.36
26 0.39
27 0.44
28 0.48
29 0.5
30 0.53
31 0.48
32 0.52
33 0.48
34 0.46
35 0.45
36 0.44
37 0.48
38 0.5
39 0.57
40 0.59
41 0.65
42 0.73
43 0.74
44 0.79
45 0.8
46 0.84
47 0.85
48 0.86
49 0.85
50 0.86
51 0.83
52 0.78
53 0.74
54 0.73
55 0.71
56 0.65
57 0.61
58 0.53
59 0.5
60 0.49
61 0.45
62 0.43
63 0.38
64 0.37
65 0.31
66 0.32
67 0.31
68 0.28
69 0.27
70 0.2
71 0.18
72 0.16
73 0.15
74 0.13