Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2V1DQC8

Protein Details
Accession A0A2V1DQC8    Localization Confidence Medium Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
4-29HLVGAKSPTSKKKKKNLLLHKTSPHSHydrophilic
NLS Segment(s)
PositionSequence
14-18KKKKK
Subcellular Location(s) nucl 17, cyto_nucl 12, mito 7
Family & Domain DBs
Amino Acid Sequences MLHHLVGAKSPTSKKKKKNLLLHKTSPHSVQNQSSSPSPTYTPPYPPPYTLTHLKECHHPHPTPPNLDRQPP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.61
2 0.69
3 0.78
4 0.82
5 0.87
6 0.88
7 0.88
8 0.88
9 0.86
10 0.83
11 0.76
12 0.68
13 0.6
14 0.52
15 0.46
16 0.4
17 0.36
18 0.33
19 0.3
20 0.3
21 0.28
22 0.27
23 0.23
24 0.21
25 0.18
26 0.17
27 0.21
28 0.21
29 0.24
30 0.28
31 0.34
32 0.34
33 0.34
34 0.36
35 0.35
36 0.38
37 0.41
38 0.4
39 0.41
40 0.43
41 0.43
42 0.49
43 0.5
44 0.53
45 0.52
46 0.49
47 0.49
48 0.56
49 0.62
50 0.62
51 0.59
52 0.62