Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2V1DEI1

Protein Details
Accession A0A2V1DEI1    Localization Confidence Medium Confidence Score 14.1
NoLS Segment(s)
PositionSequenceProtein Nature
13-41VVPYRRVVRRDPSPRRRSHQSIRRISRTEHydrophilic
153-177GPESERYERRRSRSRVRERSLSRGPBasic
NLS Segment(s)
PositionSequence
165-165R
Subcellular Location(s) nucl 21, cyto_nucl 13.333, mito_nucl 12.999, mito 3.5
Family & Domain DBs
Amino Acid Sequences MCLVKVRQEEEVVVPYRRVVRRDPSPRRRSHQSIRRISRTEVIHESPRPSASYIAVPAPKPLAIPAPQPAPIFYEQPAPAPPPIHHHHQPHHQEQRAAHYVEVSPRSSYSSHSPSRASDYVIHEQREYRRQQRRDYSPEDRSPRYEHFRYVEGPESERYERRRSRSRVRERSLSRGPADYGERVTRERVSVHVGDGRRSRDYREYR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.27
3 0.34
4 0.36
5 0.36
6 0.35
7 0.4
8 0.49
9 0.6
10 0.69
11 0.72
12 0.78
13 0.83
14 0.85
15 0.86
16 0.84
17 0.84
18 0.82
19 0.81
20 0.82
21 0.83
22 0.83
23 0.78
24 0.71
25 0.67
26 0.61
27 0.56
28 0.51
29 0.46
30 0.44
31 0.43
32 0.42
33 0.38
34 0.36
35 0.32
36 0.27
37 0.24
38 0.19
39 0.19
40 0.18
41 0.2
42 0.21
43 0.2
44 0.2
45 0.2
46 0.18
47 0.16
48 0.15
49 0.15
50 0.13
51 0.15
52 0.17
53 0.18
54 0.21
55 0.21
56 0.21
57 0.2
58 0.2
59 0.19
60 0.17
61 0.21
62 0.18
63 0.19
64 0.2
65 0.18
66 0.18
67 0.18
68 0.18
69 0.18
70 0.21
71 0.27
72 0.32
73 0.35
74 0.39
75 0.47
76 0.53
77 0.55
78 0.61
79 0.56
80 0.53
81 0.49
82 0.51
83 0.46
84 0.4
85 0.31
86 0.24
87 0.22
88 0.22
89 0.23
90 0.17
91 0.13
92 0.12
93 0.14
94 0.14
95 0.15
96 0.17
97 0.22
98 0.23
99 0.25
100 0.26
101 0.25
102 0.31
103 0.29
104 0.26
105 0.24
106 0.27
107 0.33
108 0.35
109 0.35
110 0.29
111 0.32
112 0.34
113 0.38
114 0.38
115 0.4
116 0.46
117 0.51
118 0.59
119 0.65
120 0.7
121 0.7
122 0.72
123 0.71
124 0.69
125 0.73
126 0.7
127 0.63
128 0.57
129 0.55
130 0.53
131 0.53
132 0.46
133 0.42
134 0.39
135 0.39
136 0.38
137 0.37
138 0.38
139 0.31
140 0.31
141 0.29
142 0.31
143 0.32
144 0.35
145 0.36
146 0.39
147 0.44
148 0.5
149 0.58
150 0.61
151 0.69
152 0.75
153 0.82
154 0.83
155 0.83
156 0.86
157 0.8
158 0.82
159 0.79
160 0.74
161 0.65
162 0.57
163 0.51
164 0.45
165 0.44
166 0.37
167 0.33
168 0.3
169 0.3
170 0.29
171 0.31
172 0.29
173 0.27
174 0.26
175 0.24
176 0.27
177 0.25
178 0.27
179 0.3
180 0.29
181 0.34
182 0.39
183 0.41
184 0.41
185 0.42
186 0.44