Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2V1E9D4

Protein Details
Accession A0A2V1E9D4    Localization Confidence Low Confidence Score 8.7
NoLS Segment(s)
PositionSequenceProtein Nature
14-40GSEGRGEEKKRREKKKIKSSFARENWSBasic
NLS Segment(s)
PositionSequence
18-32RGEEKKRREKKKIKS
Subcellular Location(s) cyto 11.5, cyto_nucl 7.5, mito 6, plas 3, E.R. 3, nucl 2.5
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MTHALTISDCLAGGSEGRGEEKKRREKKKIKSSFARENWSKMKVYLDLVVAADGTACIACIFACVRMMGSVCDVCNLSCP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.07
3 0.07
4 0.1
5 0.13
6 0.16
7 0.23
8 0.33
9 0.43
10 0.51
11 0.61
12 0.69
13 0.77
14 0.84
15 0.88
16 0.89
17 0.88
18 0.88
19 0.86
20 0.86
21 0.81
22 0.78
23 0.68
24 0.63
25 0.57
26 0.5
27 0.42
28 0.32
29 0.29
30 0.22
31 0.21
32 0.18
33 0.14
34 0.12
35 0.12
36 0.11
37 0.09
38 0.08
39 0.06
40 0.04
41 0.04
42 0.03
43 0.03
44 0.03
45 0.03
46 0.03
47 0.04
48 0.05
49 0.06
50 0.07
51 0.07
52 0.08
53 0.09
54 0.1
55 0.1
56 0.13
57 0.14
58 0.13
59 0.15
60 0.15