FuNGI

A0A2V1D1Q4

Protein Details

Accession

A0A2V1D1Q4

Localization Confidence

High

Confidence Score

17.2

NoLS Segment(s)

Position	Sequence	Protein Nature
25-57	QKMQATLRWHERDRKQRKQRKTEQYEYKRYRLE	Hydrophilic
429-454	EDTPRVSRAERRKIRENERKKREMET	Basic

NLS Segment(s)

Position	Sequence
15-45	AKAIAKKKAIQKMQATLRWHERDRKQRKQRK
436-450	RAERRKIRENERKKR

Subcellular Location(s)

nucl 13, mito 12

Family & Domain DBs

InterPro	View protein in InterPro IPR000048 IQ_motif_EF-hand-BS IPR005824 KOW IPR041988 KOW_RPL26/RPL24 IPR014722 Rib_L2_dom2 IPR005825 Ribosomal_L24/26_CS IPR008991 Translation_prot_SH3-like_sf
Gene Ontology	GO:0015629 C:actin cytoskeleton GO:0005840 C:ribosome GO:0003723 F:RNA binding GO:0003735 F:structural constituent of ribosome GO:0006996 P:organelle organization GO:0006412 P:translation
PROSITE	View protein in PROSITE PS50096 IQ PS01108 RIBOSOMAL_L24
CDD	cd06089 KOW_RPL26

Amino Acid Sequences

MPPISSAPVRAAPSAKAIAKKKAIQKMQATLRWHERDRKQRKQRKTEQYEYKRYRLELVKQQHNKVRNIARNALRDVREDWKLGPLRPNRVSGLQEGMYGVVTERSLSLTALPKHLSQRINEDREKQGLPPQHLVVNDKIYLPYVVGDRVVVIAGREKGKIGAIQAVDKDALMFTVQGVNTQYLDSKLLAGGDPTDKTNRAPHEIQFGINDIRLVIPYRITTASGRYIYQDVVVDNVILERHTTGVDPFTGIDYGNDEFPAEHRFDPETNLPVFKRYIAGTKRAIPWPWEKDEEKLKEKEDAVVAQEKPGFLTRVRRLPNDLRERIAARRNAAARAEEKRLEREAEELSLVDSDIAESQQLSGTRTDRPDNILTYDDDTGRNKSDPTDETLRNFSPTLAYPPFPAGLPTELLQEVREKRREAAQDALDEDTPRVSRAERRKIRENERKKREMETMKTPLQLRWEVMRAKQAAEKKEVDREQLLLALGKHMQGNGIELTPKRSQAARNAEKQLDVE

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.35
2	0.35
3	0.38
4	0.41
5	0.47
6	0.52
7	0.58
8	0.62
9	0.66
10	0.69
11	0.69
12	0.71
13	0.72
14	0.74
15	0.73
16	0.68
17	0.66
18	0.68
19	0.67
20	0.66
21	0.67
22	0.67
23	0.72
24	0.78
25	0.82
26	0.83
27	0.86
28	0.9
29	0.92
30	0.93
31	0.93
32	0.93
33	0.92
34	0.92
35	0.93
36	0.93
37	0.89
38	0.86
39	0.79
40	0.7
41	0.68
42	0.64
43	0.62
44	0.61
45	0.63
46	0.66
47	0.69
48	0.76
49	0.75
50	0.74
51	0.7
52	0.69
53	0.69
54	0.67
55	0.66
56	0.67
57	0.68
58	0.66
59	0.67
60	0.66
61	0.58
62	0.52
63	0.49
64	0.45
65	0.41
66	0.37
67	0.32
68	0.34
69	0.36
70	0.36
71	0.41
72	0.42
73	0.48
74	0.5
75	0.53
76	0.47
77	0.48
78	0.47
79	0.4
80	0.39
81	0.3
82	0.27
83	0.24
84	0.21
85	0.16
86	0.14
87	0.12
88	0.07
89	0.07
90	0.06
91	0.06
92	0.07
93	0.08
94	0.08
95	0.11
96	0.17
97	0.19
98	0.23
99	0.24
100	0.25
101	0.3
102	0.36
103	0.36
104	0.31
105	0.39
106	0.45
107	0.51
108	0.52
109	0.53
110	0.5
111	0.52
112	0.51
113	0.42
114	0.39
115	0.38
116	0.38
117	0.37
118	0.34
119	0.33
120	0.33
121	0.35
122	0.31
123	0.28
124	0.25
125	0.21
126	0.2
127	0.18
128	0.17
129	0.14
130	0.12
131	0.1
132	0.09
133	0.09
134	0.08
135	0.08
136	0.08
137	0.08
138	0.06
139	0.05
140	0.09
141	0.11
142	0.13
143	0.13
144	0.13
145	0.14
146	0.15
147	0.16
148	0.13
149	0.15
150	0.14
151	0.16
152	0.16
153	0.16
154	0.15
155	0.14
156	0.13
157	0.08
158	0.07
159	0.05
160	0.05
161	0.04
162	0.08
163	0.08
164	0.09
165	0.1
166	0.11
167	0.11
168	0.11
169	0.12
170	0.09
171	0.1
172	0.09
173	0.08
174	0.08
175	0.08
176	0.08
177	0.07
178	0.08
179	0.08
180	0.09
181	0.1
182	0.12
183	0.12
184	0.14
185	0.19
186	0.2
187	0.24
188	0.26
189	0.26
190	0.31
191	0.31
192	0.3
193	0.25
194	0.25
195	0.2
196	0.18
197	0.16
198	0.09
199	0.08
200	0.08
201	0.09
202	0.07
203	0.07
204	0.07
205	0.1
206	0.1
207	0.11
208	0.11
209	0.12
210	0.16
211	0.16
212	0.16
213	0.16
214	0.16
215	0.15
216	0.15
217	0.13
218	0.09
219	0.09
220	0.09
221	0.07
222	0.06
223	0.06
224	0.05
225	0.04
226	0.05
227	0.04
228	0.04
229	0.05
230	0.05
231	0.05
232	0.06
233	0.06
234	0.06
235	0.06
236	0.06
237	0.06
238	0.06
239	0.06
240	0.07
241	0.07
242	0.07
243	0.07
244	0.06
245	0.06
246	0.07
247	0.09
248	0.09
249	0.08
250	0.1
251	0.11
252	0.12
253	0.15
254	0.16
255	0.17
256	0.16
257	0.18
258	0.16
259	0.17
260	0.17
261	0.14
262	0.14
263	0.12
264	0.19
265	0.19
266	0.24
267	0.25
268	0.29
269	0.33
270	0.34
271	0.34
272	0.3
273	0.35
274	0.35
275	0.37
276	0.37
277	0.34
278	0.35
279	0.43
280	0.45
281	0.43
282	0.41
283	0.38
284	0.38
285	0.37
286	0.35
287	0.28
288	0.23
289	0.2
290	0.23
291	0.22
292	0.19
293	0.2
294	0.17
295	0.17
296	0.17
297	0.16
298	0.12
299	0.21
300	0.24
301	0.31
302	0.34
303	0.35
304	0.4
305	0.46
306	0.54
307	0.55
308	0.53
309	0.47
310	0.47
311	0.48
312	0.46
313	0.46
314	0.39
315	0.31
316	0.34
317	0.34
318	0.34
319	0.33
320	0.3
321	0.28
322	0.29
323	0.31
324	0.3
325	0.3
326	0.31
327	0.32
328	0.3
329	0.27
330	0.25
331	0.22
332	0.19
333	0.17
334	0.14
335	0.12
336	0.1
337	0.1
338	0.07
339	0.05
340	0.05
341	0.05
342	0.05
343	0.04
344	0.04
345	0.05
346	0.07
347	0.08
348	0.09
349	0.11
350	0.13
351	0.17
352	0.2
353	0.23
354	0.22
355	0.26
356	0.28
357	0.27
358	0.28
359	0.26
360	0.24
361	0.24
362	0.24
363	0.2
364	0.2
365	0.2
366	0.2
367	0.21
368	0.2
369	0.18
370	0.18
371	0.22
372	0.21
373	0.26
374	0.31
375	0.31
376	0.33
377	0.38
378	0.37
379	0.34
380	0.32
381	0.26
382	0.21
383	0.2
384	0.24
385	0.22
386	0.22
387	0.2
388	0.22
389	0.22
390	0.2
391	0.19
392	0.14
393	0.13
394	0.14
395	0.14
396	0.14
397	0.14
398	0.15
399	0.14
400	0.19
401	0.25
402	0.31
403	0.36
404	0.35
405	0.37
406	0.44
407	0.48
408	0.46
409	0.47
410	0.42
411	0.4
412	0.4
413	0.4
414	0.33
415	0.29
416	0.25
417	0.2
418	0.17
419	0.15
420	0.14
421	0.14
422	0.22
423	0.32
424	0.43
425	0.49
426	0.56
427	0.66
428	0.75
429	0.83
430	0.86
431	0.87
432	0.87
433	0.88
434	0.88
435	0.81
436	0.77
437	0.76
438	0.75
439	0.71
440	0.69
441	0.67
442	0.64
443	0.66
444	0.62
445	0.54
446	0.5
447	0.46
448	0.39
449	0.37
450	0.39
451	0.38
452	0.39
453	0.45
454	0.4
455	0.39
456	0.42
457	0.43
458	0.42
459	0.45
460	0.48
461	0.43
462	0.52
463	0.52
464	0.52
465	0.47
466	0.43
467	0.38
468	0.34
469	0.31
470	0.24
471	0.21
472	0.19
473	0.18
474	0.18
475	0.18
476	0.15
477	0.16
478	0.14
479	0.16
480	0.15
481	0.16
482	0.19
483	0.18
484	0.24
485	0.26
486	0.28
487	0.28
488	0.3
489	0.34
490	0.4
491	0.5
492	0.53
493	0.58
494	0.64
495	0.64

A0A2V1D1Q4

3D AlphaFold-predicted Structure Viewer