Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2V1E3M9

Protein Details
Accession A0A2V1E3M9    Localization Confidence High Confidence Score 17.7
NoLS Segment(s)
PositionSequenceProtein Nature
32-59ALKLKGAAIDKKKKKKRPKPSDSSGEPSBasic
105-129KTEAEKRHDERRRKRLEERLRREGVBasic
NLS Segment(s)
PositionSequence
34-51KLKGAAIDKKKKKKRPKP
100-133GGGRQKTEAEKRHDERRRKRLEERLRREGVKTHK
Subcellular Location(s) nucl 22, cyto_nucl 13.5, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR013865  FAM32A  
Pfam View protein in Pfam  
PF08555  FAM32A  
Amino Acid Sequences MVDEGSPVSIAHIPSNITTMPSSEYTTGGGGALKLKGAAIDKKKKKKRPKPSDSSGEPSTSTNVSRNSHTVDHKSRSASPADTPGRSLSPATAEKEIREGGGRQKTEAEKRHDERRRKRLEERLRREGVKTHKEKVEELNKYLSGLSEHHDMPKIGPG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.17
3 0.15
4 0.14
5 0.13
6 0.13
7 0.15
8 0.16
9 0.18
10 0.16
11 0.16
12 0.16
13 0.16
14 0.15
15 0.12
16 0.1
17 0.08
18 0.09
19 0.09
20 0.08
21 0.07
22 0.07
23 0.09
24 0.12
25 0.18
26 0.26
27 0.36
28 0.46
29 0.57
30 0.67
31 0.75
32 0.84
33 0.87
34 0.89
35 0.9
36 0.92
37 0.91
38 0.9
39 0.89
40 0.84
41 0.79
42 0.7
43 0.6
44 0.49
45 0.4
46 0.33
47 0.25
48 0.2
49 0.17
50 0.19
51 0.19
52 0.2
53 0.21
54 0.23
55 0.25
56 0.27
57 0.3
58 0.32
59 0.34
60 0.34
61 0.35
62 0.33
63 0.31
64 0.3
65 0.24
66 0.2
67 0.24
68 0.24
69 0.22
70 0.22
71 0.21
72 0.2
73 0.19
74 0.18
75 0.1
76 0.12
77 0.15
78 0.16
79 0.18
80 0.18
81 0.18
82 0.2
83 0.19
84 0.16
85 0.15
86 0.14
87 0.18
88 0.24
89 0.25
90 0.23
91 0.28
92 0.32
93 0.39
94 0.44
95 0.44
96 0.47
97 0.51
98 0.61
99 0.65
100 0.71
101 0.73
102 0.77
103 0.8
104 0.78
105 0.82
106 0.83
107 0.85
108 0.86
109 0.84
110 0.83
111 0.79
112 0.74
113 0.67
114 0.64
115 0.63
116 0.62
117 0.58
118 0.56
119 0.54
120 0.55
121 0.55
122 0.57
123 0.58
124 0.52
125 0.5
126 0.48
127 0.44
128 0.42
129 0.4
130 0.31
131 0.23
132 0.19
133 0.19
134 0.18
135 0.19
136 0.22
137 0.24
138 0.24