Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2V1DG23

Protein Details
Accession A0A2V1DG23    Localization Confidence High Confidence Score 18
NoLS Segment(s)
PositionSequenceProtein Nature
166-194RQGGKAGYKKGPHRPKKNRNEAKVRFIDRBasic
NLS Segment(s)
PositionSequence
169-190GKAGYKKGPHRPKKNRNEAKVR
Subcellular Location(s) nucl 25
Family & Domain DBs
Amino Acid Sequences MDNEAKTMLEKAIMTATLPRLRNTFWEICLENPQTASIACKKLLSRTNRSGNNPFLSTSPSHDTANLSSEDEEVQHEKRDEHENRKRKRDMFPTTTSVVQPRYDVCEQCDKEYDVEYNSATACIYHPGLLDGTEEFYEDVYDDDEFDHEEMFADSPELYEWNCCGRQGGKAGYKKGPHRPKKNRNEAKVRFIDR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.16
3 0.21
4 0.26
5 0.27
6 0.28
7 0.28
8 0.29
9 0.33
10 0.37
11 0.34
12 0.29
13 0.33
14 0.32
15 0.32
16 0.38
17 0.36
18 0.29
19 0.26
20 0.25
21 0.2
22 0.19
23 0.21
24 0.19
25 0.2
26 0.2
27 0.22
28 0.23
29 0.3
30 0.37
31 0.4
32 0.43
33 0.5
34 0.58
35 0.62
36 0.67
37 0.66
38 0.64
39 0.61
40 0.53
41 0.45
42 0.36
43 0.33
44 0.27
45 0.26
46 0.25
47 0.23
48 0.22
49 0.22
50 0.23
51 0.2
52 0.22
53 0.18
54 0.14
55 0.12
56 0.12
57 0.12
58 0.1
59 0.11
60 0.11
61 0.11
62 0.13
63 0.14
64 0.13
65 0.16
66 0.25
67 0.29
68 0.37
69 0.46
70 0.53
71 0.6
72 0.69
73 0.72
74 0.67
75 0.69
76 0.69
77 0.68
78 0.65
79 0.62
80 0.57
81 0.53
82 0.49
83 0.42
84 0.34
85 0.27
86 0.2
87 0.16
88 0.13
89 0.17
90 0.18
91 0.18
92 0.18
93 0.26
94 0.26
95 0.27
96 0.29
97 0.25
98 0.23
99 0.24
100 0.22
101 0.14
102 0.14
103 0.13
104 0.11
105 0.1
106 0.09
107 0.07
108 0.07
109 0.06
110 0.07
111 0.08
112 0.08
113 0.08
114 0.08
115 0.09
116 0.09
117 0.09
118 0.07
119 0.08
120 0.07
121 0.08
122 0.07
123 0.07
124 0.06
125 0.06
126 0.06
127 0.05
128 0.05
129 0.05
130 0.06
131 0.06
132 0.07
133 0.07
134 0.07
135 0.06
136 0.06
137 0.07
138 0.07
139 0.07
140 0.07
141 0.06
142 0.06
143 0.07
144 0.07
145 0.07
146 0.08
147 0.09
148 0.14
149 0.15
150 0.14
151 0.17
152 0.17
153 0.22
154 0.26
155 0.33
156 0.36
157 0.42
158 0.48
159 0.52
160 0.58
161 0.61
162 0.66
163 0.69
164 0.72
165 0.77
166 0.83
167 0.87
168 0.91
169 0.95
170 0.95
171 0.94
172 0.94
173 0.91
174 0.9