Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2V1DRB5

Protein Details
Accession A0A2V1DRB5    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
80-106VGEKKEEREREEKRKKKGVRFGYGWRGBasic
NLS Segment(s)
PositionSequence
75-100KKRRSVGEKKEEREREEKRKKKGVRF
Subcellular Location(s) mito 22.5, cyto_mito 13.5, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MFAEWWARRRRAGGGMLLRVWRGARTDTSWRRWEKSRALVVVGGRAFAGRPKASRDGVGQLDGTLGVEMVVWVVKKRRSVGEKKEEREREEKRKKKGVRFGYGWRG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.45
3 0.44
4 0.43
5 0.38
6 0.33
7 0.29
8 0.22
9 0.17
10 0.16
11 0.16
12 0.2
13 0.3
14 0.36
15 0.43
16 0.49
17 0.51
18 0.53
19 0.56
20 0.58
21 0.55
22 0.57
23 0.56
24 0.49
25 0.47
26 0.45
27 0.39
28 0.36
29 0.28
30 0.2
31 0.14
32 0.12
33 0.11
34 0.1
35 0.13
36 0.09
37 0.11
38 0.14
39 0.18
40 0.19
41 0.2
42 0.2
43 0.21
44 0.21
45 0.21
46 0.17
47 0.13
48 0.13
49 0.11
50 0.1
51 0.05
52 0.04
53 0.03
54 0.03
55 0.03
56 0.03
57 0.04
58 0.04
59 0.05
60 0.1
61 0.13
62 0.16
63 0.19
64 0.27
65 0.35
66 0.45
67 0.54
68 0.6
69 0.67
70 0.69
71 0.77
72 0.74
73 0.72
74 0.72
75 0.71
76 0.71
77 0.73
78 0.77
79 0.76
80 0.81
81 0.84
82 0.84
83 0.86
84 0.84
85 0.83
86 0.81