Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2V1EAK4

Protein Details
Accession A0A2V1EAK4    Localization Confidence Medium Confidence Score 12.3
NoLS Segment(s)
PositionSequenceProtein Nature
401-422LEESKAKRRKIAREKAEKEADDBasic
NLS Segment(s)
PositionSequence
405-417KAKRRKIAREKAE
Subcellular Location(s) nucl 15.5, cyto_nucl 11, cyto 5.5, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR036915  Cyclin-like_sf  
IPR043198  Cyclin/Ssn8  
IPR031658  Cyclin_C_2  
IPR006671  Cyclin_N  
Gene Ontology GO:0016538  F:cyclin-dependent protein serine/threonine kinase regulator activity  
GO:0006357  P:regulation of transcription by RNA polymerase II  
Pfam View protein in Pfam  
PF16899  Cyclin_C_2  
PF00134  Cyclin_N  
CDD cd20524  CYCLIN_CCNH_rpt1  
cd20525  CYCLIN_CCNH_rpt2  
Amino Acid Sequences MKLTEDVIYRNSSQFRNWSFTPTQLAELRLKTNIQACERVKANVARQRAQRAAIALDGGGASASDSERGNTPGLENGNGNENGNSNGGTPMRLDKEVDCLTVAEEMRLVDFCCETTIDLAKFIGLPSDVTATAVQFLRRFYLYNSPMTYDAPVVSRTITFIACKTDNANPNLDDYVAKLGKVTRDQILAPEYLIVQALRYNFEVRHPFRGLKGAHLELGEIARGAYTPVAPDTRTPSDLQAAITALPLPTSGAITDKKTISIENRLNNAYGFAANILKRTAQLTDAYFLFTPSQIMLASLLLADEPLTTFYLSTKLPSDSPTYTKLLTTLRSCAILFSSHRSYTSSTLSPEEQKAVKDKDKAEISALRKKLKNCRDPDKMDLVKLNQAQKRDAENASGGGLEESKAKRRKIAREKAEKEADDFWGPELGKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.41
3 0.44
4 0.43
5 0.46
6 0.43
7 0.45
8 0.48
9 0.4
10 0.41
11 0.37
12 0.4
13 0.38
14 0.39
15 0.38
16 0.33
17 0.32
18 0.31
19 0.34
20 0.37
21 0.36
22 0.42
23 0.41
24 0.45
25 0.46
26 0.44
27 0.44
28 0.43
29 0.48
30 0.46
31 0.51
32 0.51
33 0.55
34 0.62
35 0.59
36 0.55
37 0.49
38 0.44
39 0.39
40 0.33
41 0.27
42 0.19
43 0.15
44 0.13
45 0.1
46 0.07
47 0.05
48 0.04
49 0.05
50 0.05
51 0.06
52 0.07
53 0.08
54 0.1
55 0.13
56 0.14
57 0.13
58 0.14
59 0.17
60 0.18
61 0.19
62 0.17
63 0.16
64 0.21
65 0.21
66 0.21
67 0.17
68 0.17
69 0.16
70 0.17
71 0.16
72 0.11
73 0.13
74 0.13
75 0.13
76 0.13
77 0.16
78 0.19
79 0.19
80 0.2
81 0.18
82 0.25
83 0.26
84 0.25
85 0.21
86 0.18
87 0.17
88 0.2
89 0.19
90 0.12
91 0.11
92 0.11
93 0.11
94 0.11
95 0.11
96 0.08
97 0.08
98 0.08
99 0.08
100 0.08
101 0.08
102 0.1
103 0.13
104 0.13
105 0.13
106 0.13
107 0.12
108 0.12
109 0.11
110 0.1
111 0.07
112 0.07
113 0.07
114 0.09
115 0.09
116 0.09
117 0.1
118 0.09
119 0.11
120 0.12
121 0.12
122 0.12
123 0.12
124 0.13
125 0.14
126 0.14
127 0.15
128 0.23
129 0.24
130 0.27
131 0.28
132 0.27
133 0.28
134 0.28
135 0.26
136 0.17
137 0.15
138 0.12
139 0.12
140 0.1
141 0.1
142 0.09
143 0.09
144 0.1
145 0.1
146 0.09
147 0.09
148 0.14
149 0.14
150 0.14
151 0.16
152 0.21
153 0.26
154 0.28
155 0.29
156 0.25
157 0.26
158 0.26
159 0.23
160 0.17
161 0.12
162 0.16
163 0.14
164 0.13
165 0.13
166 0.14
167 0.16
168 0.18
169 0.19
170 0.15
171 0.16
172 0.16
173 0.18
174 0.18
175 0.16
176 0.13
177 0.12
178 0.1
179 0.08
180 0.09
181 0.06
182 0.05
183 0.06
184 0.07
185 0.08
186 0.09
187 0.1
188 0.1
189 0.14
190 0.22
191 0.22
192 0.28
193 0.28
194 0.28
195 0.28
196 0.34
197 0.31
198 0.26
199 0.28
200 0.22
201 0.21
202 0.2
203 0.2
204 0.13
205 0.13
206 0.09
207 0.06
208 0.05
209 0.03
210 0.03
211 0.04
212 0.03
213 0.03
214 0.04
215 0.05
216 0.06
217 0.07
218 0.08
219 0.13
220 0.15
221 0.17
222 0.17
223 0.17
224 0.19
225 0.19
226 0.18
227 0.13
228 0.12
229 0.1
230 0.09
231 0.09
232 0.06
233 0.05
234 0.05
235 0.04
236 0.04
237 0.04
238 0.04
239 0.07
240 0.08
241 0.1
242 0.13
243 0.14
244 0.14
245 0.15
246 0.17
247 0.17
248 0.24
249 0.28
250 0.29
251 0.32
252 0.32
253 0.32
254 0.3
255 0.28
256 0.2
257 0.14
258 0.1
259 0.08
260 0.1
261 0.1
262 0.11
263 0.11
264 0.1
265 0.11
266 0.12
267 0.12
268 0.1
269 0.12
270 0.12
271 0.14
272 0.14
273 0.15
274 0.14
275 0.14
276 0.13
277 0.11
278 0.1
279 0.08
280 0.08
281 0.06
282 0.07
283 0.06
284 0.06
285 0.06
286 0.05
287 0.05
288 0.04
289 0.04
290 0.04
291 0.03
292 0.03
293 0.05
294 0.05
295 0.06
296 0.06
297 0.07
298 0.09
299 0.09
300 0.11
301 0.12
302 0.13
303 0.14
304 0.16
305 0.21
306 0.21
307 0.25
308 0.27
309 0.27
310 0.26
311 0.25
312 0.26
313 0.24
314 0.26
315 0.25
316 0.24
317 0.23
318 0.25
319 0.24
320 0.22
321 0.2
322 0.19
323 0.19
324 0.21
325 0.26
326 0.25
327 0.26
328 0.27
329 0.28
330 0.28
331 0.31
332 0.27
333 0.24
334 0.26
335 0.29
336 0.31
337 0.31
338 0.32
339 0.28
340 0.28
341 0.34
342 0.38
343 0.4
344 0.43
345 0.43
346 0.47
347 0.49
348 0.48
349 0.45
350 0.46
351 0.46
352 0.48
353 0.52
354 0.52
355 0.52
356 0.58
357 0.64
358 0.67
359 0.7
360 0.7
361 0.74
362 0.76
363 0.78
364 0.78
365 0.78
366 0.7
367 0.65
368 0.61
369 0.54
370 0.52
371 0.51
372 0.53
373 0.46
374 0.46
375 0.45
376 0.44
377 0.47
378 0.45
379 0.41
380 0.36
381 0.34
382 0.32
383 0.29
384 0.25
385 0.19
386 0.14
387 0.13
388 0.1
389 0.15
390 0.17
391 0.26
392 0.33
393 0.34
394 0.42
395 0.5
396 0.61
397 0.66
398 0.73
399 0.75
400 0.8
401 0.83
402 0.85
403 0.86
404 0.76
405 0.68
406 0.61
407 0.54
408 0.46
409 0.41
410 0.32
411 0.29