Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2V1E414

Protein Details
Accession A0A2V1E414   
Localization Confidence Medium
Confidence Score 10.9
NoLS Segment(s)
PositionSequenceProtein Nature
84-112PPSSVSLPSSRKRRRRARSRSPPYPTYIKHydrophilic
NLS Segment(s)
PositionSequence
93-104SRKRRRRARSRS
Subcellular Location(s) nucl 11.5, mito 10.5, cyto_nucl 7.833, cyto_mito 7.333, cyto 3
Family & Domain DBs
PROSITE View protein in PROSITE  
PS51257  PROKAR_LIPOPROTEIN  
Amino Acid Sequences MRKNPLGIHFLVLCFLSSCLSLTSFTTNKRFELFTTNKRFEIISVASTTLCLTPTHPHTHTHKTPSFDSPTFMPQTHTHTHTHPPSSVSLPSSRKRRRRARSRSPPYPTYIKH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.12
3 0.09
4 0.08
5 0.09
6 0.09
7 0.09
8 0.1
9 0.1
10 0.16
11 0.18
12 0.21
13 0.27
14 0.28
15 0.28
16 0.29
17 0.29
18 0.25
19 0.32
20 0.34
21 0.37
22 0.45
23 0.47
24 0.45
25 0.45
26 0.43
27 0.34
28 0.32
29 0.24
30 0.16
31 0.14
32 0.14
33 0.14
34 0.14
35 0.14
36 0.09
37 0.08
38 0.07
39 0.07
40 0.1
41 0.14
42 0.19
43 0.2
44 0.23
45 0.28
46 0.36
47 0.38
48 0.42
49 0.42
50 0.41
51 0.42
52 0.43
53 0.44
54 0.36
55 0.34
56 0.28
57 0.29
58 0.28
59 0.26
60 0.24
61 0.2
62 0.26
63 0.28
64 0.29
65 0.27
66 0.28
67 0.36
68 0.37
69 0.39
70 0.34
71 0.32
72 0.32
73 0.33
74 0.32
75 0.27
76 0.29
77 0.32
78 0.38
79 0.47
80 0.55
81 0.61
82 0.69
83 0.78
84 0.82
85 0.87
86 0.9
87 0.91
88 0.92
89 0.94
90 0.94
91 0.91
92 0.85
93 0.8