Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2V1DD95

Protein Details
Accession A0A2V1DD95   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MSTTRRTHRGSRSSYSRQRGYHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 10, mito 8, extr 5, E.R. 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR026030  Pur-cyt_permease_Fcy2/21/22  
Gene Ontology GO:0016020  C:membrane  
GO:0022857  F:transmembrane transporter activity  
Amino Acid Sequences MSTTRRTHRGSRSSYSRQRGYGSLLLSSICSASASPPASLPAISVGVLVAAGFDGLAGFGSVCAVIIALGIIANSVPGVYSAALGFQVLGRYGKAVLRYRRAEPHLGRIQERARAHGEYLIFRRGEGFDWTRWEDKVYLPVGVAALVVFLVGWLGAVLGMSQVYYVGRLAELVGGSDIGLWVDCDFTLLVFTPLRRLGLKWLGK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.8
3 0.75
4 0.69
5 0.65
6 0.58
7 0.54
8 0.48
9 0.4
10 0.32
11 0.27
12 0.24
13 0.21
14 0.19
15 0.13
16 0.08
17 0.07
18 0.06
19 0.07
20 0.13
21 0.14
22 0.14
23 0.14
24 0.16
25 0.16
26 0.16
27 0.15
28 0.11
29 0.1
30 0.1
31 0.09
32 0.07
33 0.06
34 0.06
35 0.05
36 0.03
37 0.02
38 0.02
39 0.02
40 0.02
41 0.02
42 0.02
43 0.02
44 0.02
45 0.02
46 0.02
47 0.03
48 0.03
49 0.03
50 0.03
51 0.03
52 0.02
53 0.02
54 0.02
55 0.02
56 0.02
57 0.02
58 0.02
59 0.02
60 0.02
61 0.02
62 0.02
63 0.02
64 0.02
65 0.03
66 0.03
67 0.04
68 0.04
69 0.04
70 0.04
71 0.04
72 0.04
73 0.04
74 0.04
75 0.05
76 0.05
77 0.05
78 0.05
79 0.06
80 0.07
81 0.12
82 0.18
83 0.22
84 0.29
85 0.32
86 0.34
87 0.39
88 0.41
89 0.42
90 0.37
91 0.42
92 0.41
93 0.4
94 0.38
95 0.37
96 0.36
97 0.35
98 0.34
99 0.28
100 0.25
101 0.24
102 0.23
103 0.22
104 0.21
105 0.18
106 0.2
107 0.21
108 0.18
109 0.17
110 0.18
111 0.16
112 0.16
113 0.18
114 0.18
115 0.16
116 0.2
117 0.24
118 0.24
119 0.23
120 0.24
121 0.2
122 0.18
123 0.22
124 0.19
125 0.16
126 0.15
127 0.15
128 0.13
129 0.12
130 0.11
131 0.05
132 0.04
133 0.03
134 0.03
135 0.02
136 0.02
137 0.02
138 0.02
139 0.02
140 0.02
141 0.02
142 0.02
143 0.02
144 0.02
145 0.03
146 0.03
147 0.03
148 0.03
149 0.03
150 0.03
151 0.04
152 0.05
153 0.05
154 0.05
155 0.05
156 0.06
157 0.07
158 0.07
159 0.06
160 0.06
161 0.06
162 0.06
163 0.06
164 0.06
165 0.04
166 0.05
167 0.04
168 0.04
169 0.05
170 0.05
171 0.06
172 0.06
173 0.06
174 0.07
175 0.08
176 0.1
177 0.12
178 0.12
179 0.16
180 0.18
181 0.21
182 0.2
183 0.21
184 0.27