Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2V1E9X0

Protein Details
Accession A0A2V1E9X0   
Localization Confidence Medium
Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-31MPKEKTTRGKGKKAEGGKKKKDPNAPKRGLSBasic
NLS Segment(s)
PositionSequence
5-28KTTRGKGKKAEGGKKKKDPNAPKR
Subcellular Location(s) nucl 15.5, cyto_nucl 12.5, cyto 8.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009071  HMG_box_dom  
IPR036910  HMG_box_dom_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
Pfam View protein in Pfam  
PF00505  HMG_box  
PROSITE View protein in PROSITE  
PS50118  HMG_BOX_2  
CDD cd01390  HMG-box_NHP6-like  
Amino Acid Sequences MPKEKTTRGKGKKAEGGKKKKDPNAPKRGLSAYMFFANDQRDKVREENPGIKFGDVGKMLGEKWKTLSDKQRAPYEAKAAADKKRYEDEKAAYAVRLVCIAPVFSLHD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.8
3 0.82
4 0.82
5 0.84
6 0.84
7 0.84
8 0.84
9 0.85
10 0.85
11 0.85
12 0.81
13 0.74
14 0.7
15 0.64
16 0.58
17 0.48
18 0.4
19 0.31
20 0.27
21 0.25
22 0.21
23 0.21
24 0.2
25 0.2
26 0.19
27 0.18
28 0.17
29 0.2
30 0.22
31 0.24
32 0.26
33 0.29
34 0.35
35 0.35
36 0.37
37 0.34
38 0.31
39 0.27
40 0.22
41 0.21
42 0.14
43 0.12
44 0.09
45 0.09
46 0.09
47 0.13
48 0.13
49 0.1
50 0.11
51 0.16
52 0.18
53 0.23
54 0.33
55 0.37
56 0.42
57 0.46
58 0.51
59 0.49
60 0.5
61 0.48
62 0.44
63 0.39
64 0.34
65 0.36
66 0.34
67 0.37
68 0.4
69 0.38
70 0.37
71 0.42
72 0.44
73 0.43
74 0.45
75 0.43
76 0.41
77 0.43
78 0.4
79 0.32
80 0.32
81 0.28
82 0.22
83 0.19
84 0.14
85 0.12
86 0.12
87 0.12
88 0.1