Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2V1DS52

Protein Details
Accession A0A2V1DS52    Localization Confidence Low Confidence Score 5.5
NoLS Segment(s)
PositionSequenceProtein Nature
227-246QGCEIGRKRRRRQTGEALTYHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 21, cyto_nucl 2, nucl 1.5, cyto 1.5, mito 1, E.R. 1, vacu 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR013320  ConA-like_dom_sf  
IPR000757  GH16  
Gene Ontology GO:0016020  C:membrane  
GO:0004553  F:hydrolase activity, hydrolyzing O-glycosyl compounds  
GO:0005975  P:carbohydrate metabolic process  
PROSITE View protein in PROSITE  
PS51762  GH16_2  
CDD cd02181  GH16_fungal_Lam16A_glucanase  
Amino Acid Sequences MASLHSPDKSPASEKSTQVGLHGSPKAPEDETIAEGKTTLNPKPWPLRTWILIGIVLVIVVIGAIVGGVLGARANAYPDYYRIEYSLKDAYEGNTFFDKFDYFSDEDPTHGFVEYMNSTYSTLQQLTRLTSTPERNSLSPSGTAILRVDNTTTNATDGRRSVRITSRPTYSTGLFIFDIHHSPYGCATWPAVWLSDIPNWPTNGEIDVVEAVNMGDTGNQMTLHTTQGCEIGRKRRRRQTGEALTYDCWNATDGNVGCGVQGEKATYGKAFNAQGGGVYAVELRDEGIRVWMFDRSNIPADIVSRTPDPSTWETALADFPNLECDIERYFKDLSIVVNISLCGDWAGQDNVFGANPVCKMKGKCEDFVKSNPGEFDEAYWEFGGFWVYQGV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.43
3 0.43
4 0.4
5 0.38
6 0.35
7 0.29
8 0.3
9 0.32
10 0.3
11 0.27
12 0.29
13 0.3
14 0.27
15 0.26
16 0.24
17 0.22
18 0.24
19 0.24
20 0.23
21 0.19
22 0.18
23 0.18
24 0.2
25 0.21
26 0.22
27 0.26
28 0.29
29 0.36
30 0.46
31 0.5
32 0.47
33 0.49
34 0.52
35 0.48
36 0.49
37 0.45
38 0.37
39 0.32
40 0.29
41 0.23
42 0.16
43 0.13
44 0.09
45 0.06
46 0.03
47 0.03
48 0.02
49 0.01
50 0.01
51 0.01
52 0.01
53 0.01
54 0.01
55 0.01
56 0.02
57 0.02
58 0.02
59 0.03
60 0.03
61 0.05
62 0.06
63 0.08
64 0.09
65 0.11
66 0.17
67 0.18
68 0.18
69 0.18
70 0.2
71 0.19
72 0.21
73 0.25
74 0.19
75 0.19
76 0.19
77 0.19
78 0.23
79 0.22
80 0.21
81 0.2
82 0.2
83 0.19
84 0.2
85 0.19
86 0.14
87 0.15
88 0.18
89 0.16
90 0.17
91 0.21
92 0.2
93 0.2
94 0.2
95 0.21
96 0.16
97 0.14
98 0.13
99 0.09
100 0.13
101 0.13
102 0.13
103 0.11
104 0.11
105 0.12
106 0.13
107 0.14
108 0.13
109 0.13
110 0.13
111 0.15
112 0.16
113 0.18
114 0.19
115 0.18
116 0.19
117 0.24
118 0.29
119 0.29
120 0.33
121 0.33
122 0.32
123 0.35
124 0.33
125 0.29
126 0.24
127 0.22
128 0.18
129 0.15
130 0.15
131 0.12
132 0.11
133 0.1
134 0.1
135 0.1
136 0.09
137 0.11
138 0.12
139 0.12
140 0.12
141 0.13
142 0.13
143 0.14
144 0.15
145 0.16
146 0.17
147 0.18
148 0.21
149 0.26
150 0.32
151 0.36
152 0.38
153 0.38
154 0.37
155 0.39
156 0.38
157 0.32
158 0.28
159 0.22
160 0.2
161 0.17
162 0.15
163 0.14
164 0.12
165 0.13
166 0.11
167 0.12
168 0.11
169 0.11
170 0.11
171 0.1
172 0.09
173 0.09
174 0.08
175 0.07
176 0.08
177 0.08
178 0.08
179 0.07
180 0.07
181 0.09
182 0.12
183 0.12
184 0.13
185 0.15
186 0.15
187 0.15
188 0.14
189 0.13
190 0.1
191 0.1
192 0.08
193 0.06
194 0.07
195 0.06
196 0.06
197 0.05
198 0.04
199 0.04
200 0.04
201 0.03
202 0.03
203 0.03
204 0.04
205 0.04
206 0.04
207 0.04
208 0.06
209 0.07
210 0.08
211 0.08
212 0.08
213 0.08
214 0.12
215 0.12
216 0.15
217 0.18
218 0.27
219 0.35
220 0.45
221 0.54
222 0.6
223 0.69
224 0.73
225 0.78
226 0.79
227 0.81
228 0.77
229 0.71
230 0.64
231 0.55
232 0.48
233 0.39
234 0.28
235 0.18
236 0.12
237 0.09
238 0.07
239 0.12
240 0.12
241 0.12
242 0.13
243 0.12
244 0.12
245 0.12
246 0.13
247 0.07
248 0.07
249 0.07
250 0.08
251 0.08
252 0.09
253 0.09
254 0.1
255 0.1
256 0.13
257 0.13
258 0.13
259 0.13
260 0.12
261 0.12
262 0.12
263 0.11
264 0.07
265 0.06
266 0.06
267 0.05
268 0.05
269 0.05
270 0.05
271 0.05
272 0.06
273 0.06
274 0.1
275 0.1
276 0.11
277 0.12
278 0.15
279 0.15
280 0.17
281 0.2
282 0.19
283 0.22
284 0.21
285 0.21
286 0.18
287 0.19
288 0.2
289 0.18
290 0.17
291 0.15
292 0.16
293 0.16
294 0.16
295 0.21
296 0.21
297 0.26
298 0.25
299 0.25
300 0.24
301 0.24
302 0.26
303 0.2
304 0.18
305 0.12
306 0.11
307 0.13
308 0.13
309 0.12
310 0.09
311 0.11
312 0.14
313 0.17
314 0.17
315 0.17
316 0.18
317 0.18
318 0.2
319 0.19
320 0.17
321 0.19
322 0.2
323 0.17
324 0.17
325 0.16
326 0.16
327 0.14
328 0.13
329 0.08
330 0.07
331 0.08
332 0.1
333 0.12
334 0.11
335 0.11
336 0.12
337 0.12
338 0.12
339 0.12
340 0.1
341 0.11
342 0.13
343 0.15
344 0.17
345 0.22
346 0.24
347 0.32
348 0.42
349 0.44
350 0.49
351 0.55
352 0.6
353 0.59
354 0.64
355 0.62
356 0.54
357 0.52
358 0.47
359 0.41
360 0.37
361 0.32
362 0.27
363 0.26
364 0.25
365 0.24
366 0.23
367 0.2
368 0.17
369 0.17
370 0.18
371 0.11