Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E2M3B3

Protein Details
Accession E2M3B3    Localization Confidence Medium Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
22-49APQRQQTSKTTMKKKKGRAKTSVHQDNEHydrophilic
NLS Segment(s)
PositionSequence
34-40KKKKGRA
Subcellular Location(s) nucl 17.5, cyto_nucl 12.5, cyto 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR004919  DUF262  
KEGG mpr:MPER_14649  -  
Pfam View protein in Pfam  
PF03235  DUF262  
Amino Acid Sequences MDSDSEVSSQLTDEDELDQEYAPQRQQTSKTTMKKKKGRAKTSVHQDNEYTLQNALKPPRATTYTAQALFEQIHLGGIDLDPEYQRDVVWTKEKQSQLIDSILRNYYIPPIIFAVTTHDD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.1
3 0.11
4 0.11
5 0.11
6 0.11
7 0.13
8 0.14
9 0.14
10 0.16
11 0.17
12 0.21
13 0.26
14 0.29
15 0.35
16 0.42
17 0.49
18 0.58
19 0.65
20 0.71
21 0.75
22 0.81
23 0.83
24 0.84
25 0.84
26 0.82
27 0.81
28 0.8
29 0.82
30 0.81
31 0.73
32 0.64
33 0.56
34 0.49
35 0.43
36 0.35
37 0.25
38 0.16
39 0.14
40 0.13
41 0.16
42 0.16
43 0.18
44 0.17
45 0.17
46 0.2
47 0.22
48 0.24
49 0.23
50 0.27
51 0.27
52 0.27
53 0.27
54 0.24
55 0.22
56 0.19
57 0.18
58 0.12
59 0.07
60 0.06
61 0.05
62 0.06
63 0.05
64 0.04
65 0.05
66 0.05
67 0.05
68 0.05
69 0.06
70 0.07
71 0.07
72 0.07
73 0.08
74 0.1
75 0.14
76 0.21
77 0.22
78 0.25
79 0.32
80 0.34
81 0.35
82 0.36
83 0.35
84 0.31
85 0.34
86 0.32
87 0.26
88 0.29
89 0.27
90 0.24
91 0.22
92 0.2
93 0.19
94 0.21
95 0.2
96 0.18
97 0.19
98 0.19
99 0.19
100 0.18