Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2V1DFE1

Protein Details
Accession A0A2V1DFE1    Localization Confidence Medium Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
57-76KCNAEKPKRRGEKPIVRCEPBasic
NLS Segment(s)
Subcellular Location(s) nucl 24.5, cyto_nucl 15
Family & Domain DBs
InterPro View protein in InterPro  
IPR024645  Mitochondr_Som1  
Gene Ontology GO:0042720  C:mitochondrial inner membrane peptidase complex  
Pfam View protein in Pfam  
PF11093  Mitochondr_Som1  
Amino Acid Sequences MSPPLHLIPVSELEQHVTSPQPNSPFSTNPSQRTRKNNAPPPRALTDCALKELTQYKCNAEKPKRRGEKPIVRCEPVVRLFRE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.18
3 0.16
4 0.15
5 0.14
6 0.15
7 0.18
8 0.19
9 0.2
10 0.24
11 0.26
12 0.25
13 0.28
14 0.36
15 0.38
16 0.41
17 0.48
18 0.51
19 0.54
20 0.61
21 0.64
22 0.64
23 0.68
24 0.71
25 0.72
26 0.71
27 0.67
28 0.64
29 0.6
30 0.52
31 0.44
32 0.36
33 0.32
34 0.27
35 0.27
36 0.22
37 0.18
38 0.19
39 0.24
40 0.26
41 0.23
42 0.24
43 0.26
44 0.31
45 0.38
46 0.46
47 0.49
48 0.56
49 0.6
50 0.7
51 0.76
52 0.74
53 0.78
54 0.78
55 0.79
56 0.79
57 0.83
58 0.79
59 0.72
60 0.7
61 0.63
62 0.61
63 0.57