Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2V1D5E9

Protein Details
Accession A0A2V1D5E9    Localization Confidence Low Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-25MPNIIRRPRSRQPERRHHRACAPGTHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 15.5, cyto_nucl 11, mito 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR025246  IS30-like_HTH  
Pfam View protein in Pfam  
PF13936  HTH_38  
Amino Acid Sequences MPNIIRRPRSRQPERRHHRACAPGTHLTYEERRRIYRLSQDQGCSQRVIATNLQLPRTTVQSAIHAMSGTRRQQQSRTRPLITPVPDFAPAAASDHDAVHKLSVFNKGMQMQMALQQPHPRNLTSATPSIPPIAAFMPDDHHSQPSQPAVAGSHWSNPQLNDLLTECSNPQRFNGHEGAFGASLPPRPPKLAPMEPRIAYESS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.89
2 0.91
3 0.88
4 0.83
5 0.81
6 0.8
7 0.75
8 0.71
9 0.68
10 0.64
11 0.59
12 0.54
13 0.47
14 0.41
15 0.44
16 0.43
17 0.44
18 0.41
19 0.41
20 0.43
21 0.45
22 0.47
23 0.49
24 0.51
25 0.53
26 0.53
27 0.54
28 0.58
29 0.59
30 0.55
31 0.45
32 0.36
33 0.32
34 0.29
35 0.3
36 0.25
37 0.23
38 0.26
39 0.28
40 0.3
41 0.25
42 0.24
43 0.21
44 0.23
45 0.2
46 0.17
47 0.15
48 0.16
49 0.18
50 0.17
51 0.16
52 0.13
53 0.12
54 0.14
55 0.19
56 0.2
57 0.24
58 0.27
59 0.28
60 0.36
61 0.45
62 0.52
63 0.57
64 0.6
65 0.56
66 0.54
67 0.56
68 0.55
69 0.48
70 0.4
71 0.31
72 0.27
73 0.25
74 0.23
75 0.2
76 0.14
77 0.11
78 0.1
79 0.09
80 0.08
81 0.08
82 0.08
83 0.08
84 0.08
85 0.08
86 0.07
87 0.07
88 0.07
89 0.08
90 0.13
91 0.14
92 0.14
93 0.16
94 0.16
95 0.16
96 0.16
97 0.15
98 0.1
99 0.14
100 0.16
101 0.15
102 0.15
103 0.22
104 0.23
105 0.27
106 0.29
107 0.24
108 0.22
109 0.24
110 0.26
111 0.23
112 0.23
113 0.2
114 0.19
115 0.2
116 0.19
117 0.17
118 0.13
119 0.11
120 0.1
121 0.09
122 0.09
123 0.09
124 0.11
125 0.13
126 0.15
127 0.15
128 0.16
129 0.16
130 0.16
131 0.19
132 0.17
133 0.16
134 0.14
135 0.13
136 0.13
137 0.14
138 0.16
139 0.14
140 0.16
141 0.17
142 0.19
143 0.2
144 0.19
145 0.21
146 0.2
147 0.19
148 0.17
149 0.17
150 0.18
151 0.17
152 0.18
153 0.16
154 0.22
155 0.25
156 0.24
157 0.24
158 0.27
159 0.28
160 0.32
161 0.38
162 0.31
163 0.29
164 0.3
165 0.31
166 0.25
167 0.23
168 0.19
169 0.14
170 0.16
171 0.17
172 0.22
173 0.22
174 0.26
175 0.27
176 0.33
177 0.4
178 0.47
179 0.52
180 0.54
181 0.59
182 0.57
183 0.58