Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2V1DPP4

Protein Details
Accession A0A2V1DPP4    Localization Confidence Medium Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
42-67IGLCCVLSQRRRRREKRKAEIVREVDHydrophilic
NLS Segment(s)
PositionSequence
51-80RRRRREKRKAEIVREVDLRVKERLRRERER
Subcellular Location(s) cyto_nucl 10, nucl 8.5, cyto 8.5, mito 5, plas 1, extr 1, pero 1, E.R. 1, vacu 1
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MPRHILPFSPLTPRDNTDRSKDSLRITTYAIIVAIVLLVAFIGLCCVLSQRRRRREKRKAEIVREVDLRVKERLRRERERNEGSRGYTGREGEGEGNQPPPPPYRSNTEAGDKGLNTKDVGAV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.42
3 0.43
4 0.42
5 0.44
6 0.45
7 0.47
8 0.48
9 0.45
10 0.45
11 0.44
12 0.38
13 0.36
14 0.34
15 0.28
16 0.25
17 0.2
18 0.13
19 0.1
20 0.08
21 0.06
22 0.03
23 0.03
24 0.02
25 0.02
26 0.02
27 0.02
28 0.01
29 0.02
30 0.02
31 0.02
32 0.02
33 0.04
34 0.08
35 0.15
36 0.25
37 0.35
38 0.45
39 0.56
40 0.66
41 0.76
42 0.84
43 0.88
44 0.89
45 0.9
46 0.89
47 0.85
48 0.83
49 0.75
50 0.67
51 0.57
52 0.48
53 0.4
54 0.33
55 0.28
56 0.23
57 0.23
58 0.24
59 0.32
60 0.41
61 0.46
62 0.54
63 0.61
64 0.67
65 0.74
66 0.78
67 0.73
68 0.7
69 0.65
70 0.58
71 0.55
72 0.47
73 0.4
74 0.35
75 0.31
76 0.25
77 0.22
78 0.21
79 0.17
80 0.18
81 0.17
82 0.15
83 0.16
84 0.16
85 0.17
86 0.17
87 0.2
88 0.23
89 0.24
90 0.26
91 0.32
92 0.36
93 0.39
94 0.41
95 0.44
96 0.42
97 0.41
98 0.42
99 0.34
100 0.35
101 0.33
102 0.3
103 0.24