Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E2LXU2

Protein Details
Accession E2LXU2    Localization Confidence Medium Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
19-38APSKSELKKRAKEAEKAKKABasic
NLS Segment(s)
PositionSequence
22-42KSELKKRAKEAEKAKKAAEKA
Subcellular Location(s) cyto_nucl 13.5, nucl 13, cyto 10
Family & Domain DBs
InterPro View protein in InterPro  
IPR004523  Asp-tRNA_synthase_2  
IPR012340  NA-bd_OB-fold  
IPR004365  NA-bd_OB_tRNA  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0004815  F:aspartate-tRNA ligase activity  
GO:0005524  F:ATP binding  
GO:0003676  F:nucleic acid binding  
GO:0006422  P:aspartyl-tRNA aminoacylation  
KEGG mpr:MPER_12111  -  
Pfam View protein in Pfam  
PF01336  tRNA_anti-codon  
CDD cd04320  AspRS_cyto_N  
Amino Acid Sequences MAETDPQVTQEQNPPAEGAPSKSELKKRAKEAEKAKKAAEKAARQQEIAAQQAAAEVDFAQDFYGALPLHQSQSRPGRTRVQISSLSSRDGETVLFRARVHTSRAQGNKMVFLNLRQRTDSVQALLFVTPEKVSKQMVKWAASLADESIVLVEGIVKKTPEPIKSASVEDVEVHISQVGIIEWWFIAQLHLISGLDGRLPFTVDDANRPYFEIDAECGQFN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.27
3 0.3
4 0.28
5 0.23
6 0.21
7 0.24
8 0.28
9 0.33
10 0.39
11 0.44
12 0.53
13 0.58
14 0.62
15 0.68
16 0.7
17 0.74
18 0.78
19 0.8
20 0.8
21 0.75
22 0.71
23 0.66
24 0.6
25 0.6
26 0.57
27 0.54
28 0.54
29 0.61
30 0.59
31 0.53
32 0.52
33 0.49
34 0.44
35 0.38
36 0.29
37 0.19
38 0.16
39 0.17
40 0.16
41 0.11
42 0.07
43 0.05
44 0.05
45 0.05
46 0.05
47 0.04
48 0.04
49 0.05
50 0.04
51 0.07
52 0.07
53 0.07
54 0.09
55 0.09
56 0.12
57 0.13
58 0.14
59 0.17
60 0.26
61 0.33
62 0.35
63 0.38
64 0.44
65 0.47
66 0.52
67 0.48
68 0.44
69 0.4
70 0.4
71 0.43
72 0.36
73 0.33
74 0.27
75 0.26
76 0.21
77 0.18
78 0.15
79 0.09
80 0.1
81 0.1
82 0.11
83 0.1
84 0.12
85 0.14
86 0.16
87 0.19
88 0.21
89 0.22
90 0.28
91 0.31
92 0.31
93 0.32
94 0.3
95 0.29
96 0.25
97 0.24
98 0.17
99 0.18
100 0.24
101 0.25
102 0.26
103 0.23
104 0.23
105 0.24
106 0.27
107 0.25
108 0.17
109 0.14
110 0.13
111 0.14
112 0.13
113 0.11
114 0.08
115 0.08
116 0.07
117 0.07
118 0.07
119 0.08
120 0.1
121 0.13
122 0.14
123 0.21
124 0.25
125 0.26
126 0.26
127 0.25
128 0.24
129 0.21
130 0.2
131 0.13
132 0.09
133 0.07
134 0.07
135 0.06
136 0.05
137 0.04
138 0.04
139 0.05
140 0.06
141 0.08
142 0.09
143 0.09
144 0.09
145 0.16
146 0.21
147 0.21
148 0.23
149 0.26
150 0.29
151 0.32
152 0.33
153 0.29
154 0.25
155 0.24
156 0.2
157 0.18
158 0.15
159 0.13
160 0.11
161 0.1
162 0.08
163 0.07
164 0.07
165 0.06
166 0.05
167 0.05
168 0.05
169 0.05
170 0.05
171 0.05
172 0.05
173 0.05
174 0.06
175 0.06
176 0.06
177 0.07
178 0.07
179 0.07
180 0.08
181 0.08
182 0.09
183 0.08
184 0.09
185 0.09
186 0.1
187 0.1
188 0.11
189 0.16
190 0.16
191 0.22
192 0.25
193 0.28
194 0.28
195 0.29
196 0.28
197 0.23
198 0.23
199 0.19
200 0.18
201 0.19