Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2V1DND8

Protein Details
Accession A0A2V1DND8    Localization Confidence High Confidence Score 16.4
NoLS Segment(s)
PositionSequenceProtein Nature
180-210ANLLSDKHDKKKDKKHKKHKKHGSGSHAGSABasic
215-240LYGGSSHGKKHKKHKEHKRGGSGSSSBasic
NLS Segment(s)
PositionSequence
187-235HDKKKDKKHKKHKKHGSGSHAGSAGLGGLYGGSSHGKKHKKHKEHKRGG
Subcellular Location(s) nucl 24.5, cyto_nucl 14
Family & Domain DBs
Amino Acid Sequences MSNQSYYGGDGTHQGGQYPPQGHSPYPQQQQYGQGQYNQSQQSPYPQQQSPYPAPPPSHSPYPQQGYGAPPPGDDLYTQHGQQPYDHNRSHSPYPPQQPPYGAPPQQGYGDQGYPPQQHTQGQYGQPGAPGAPGGPGGPEGDRGLGSTLLGGAGGAFVGHKMGGGVLGTMGGMVAGAVGANLLSDKHDKKKDKKHKKHKKHGSGSHAGSAGLGGLYGGSSHGKKHKKHKEHKRGGSGSSSSSSSSDSD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.17
3 0.19
4 0.25
5 0.25
6 0.24
7 0.27
8 0.29
9 0.29
10 0.33
11 0.4
12 0.42
13 0.48
14 0.5
15 0.46
16 0.46
17 0.53
18 0.55
19 0.53
20 0.46
21 0.43
22 0.42
23 0.43
24 0.48
25 0.43
26 0.37
27 0.31
28 0.29
29 0.34
30 0.38
31 0.41
32 0.4
33 0.39
34 0.41
35 0.43
36 0.5
37 0.47
38 0.45
39 0.44
40 0.41
41 0.42
42 0.42
43 0.44
44 0.42
45 0.44
46 0.4
47 0.42
48 0.46
49 0.49
50 0.47
51 0.41
52 0.37
53 0.35
54 0.37
55 0.37
56 0.29
57 0.24
58 0.25
59 0.24
60 0.23
61 0.18
62 0.16
63 0.15
64 0.17
65 0.17
66 0.19
67 0.21
68 0.21
69 0.22
70 0.29
71 0.31
72 0.37
73 0.38
74 0.37
75 0.38
76 0.42
77 0.45
78 0.42
79 0.41
80 0.42
81 0.47
82 0.52
83 0.52
84 0.49
85 0.46
86 0.42
87 0.42
88 0.41
89 0.36
90 0.3
91 0.28
92 0.28
93 0.26
94 0.25
95 0.2
96 0.15
97 0.14
98 0.13
99 0.13
100 0.15
101 0.15
102 0.17
103 0.16
104 0.16
105 0.17
106 0.19
107 0.21
108 0.22
109 0.22
110 0.22
111 0.21
112 0.2
113 0.18
114 0.15
115 0.12
116 0.08
117 0.07
118 0.05
119 0.04
120 0.04
121 0.04
122 0.04
123 0.04
124 0.05
125 0.05
126 0.06
127 0.06
128 0.06
129 0.06
130 0.07
131 0.07
132 0.06
133 0.06
134 0.05
135 0.05
136 0.04
137 0.04
138 0.03
139 0.02
140 0.02
141 0.02
142 0.02
143 0.02
144 0.02
145 0.02
146 0.02
147 0.02
148 0.03
149 0.03
150 0.03
151 0.03
152 0.03
153 0.03
154 0.03
155 0.03
156 0.03
157 0.03
158 0.02
159 0.02
160 0.02
161 0.02
162 0.01
163 0.01
164 0.01
165 0.02
166 0.02
167 0.02
168 0.02
169 0.02
170 0.05
171 0.1
172 0.14
173 0.22
174 0.31
175 0.4
176 0.5
177 0.62
178 0.71
179 0.78
180 0.86
181 0.89
182 0.92
183 0.95
184 0.97
185 0.97
186 0.97
187 0.96
188 0.94
189 0.91
190 0.89
191 0.81
192 0.74
193 0.63
194 0.52
195 0.41
196 0.31
197 0.22
198 0.12
199 0.09
200 0.04
201 0.03
202 0.03
203 0.03
204 0.04
205 0.07
206 0.08
207 0.13
208 0.22
209 0.3
210 0.38
211 0.49
212 0.59
213 0.67
214 0.78
215 0.85
216 0.88
217 0.91
218 0.94
219 0.94
220 0.88
221 0.81
222 0.78
223 0.69
224 0.61
225 0.53
226 0.43
227 0.34
228 0.29